triangle PDBeMotif: 2iug  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification transferase    | release date: Sat, Jun 3, 2006
Title crystal structure of the pi3-kinase p85 n-terminal sh2 domain
Authors J.SCHLESSINGER, M.J.ECK, R.T.NOLTE, S.C.HARRISON, S.E.SHOELSON
Method X-RAY DIFFRACTION (resolution: 1.89Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GMNNNMSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSS
VVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKED
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY ALPHASUBUNIT;
member of: CATH:search3.30.505.10GENE3D:searchG3DSA_3.30.505.10PANTHER:searchPTHR10155/searchPTHR10155_SF3PFAM:searchPF00017PFAMB:searchPB014608PRINTS:searchPI3KINASEP85/searchSH2DOMAINPROSITE PROFILES:searchPS50001, SMART:searchSM00252SUPERFAMILY:searchSSF55550UniProt:searchP27986
sec str:  ...hhhhhh........hhhhhhhhhh.....eeeeee..hhhhh.eeeeeee..eeeeeeeeee..eee........hhhhhhhhhhhhhhhhhhhhhh....ee......
sequence :  ..NNMSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQ
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. ^***  |  |    | ||||| || ||  |      ||| |     | |                      | | |  |    | ^***| || |              
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ||||  |  |    | ||||| || ||  |      ^** |     ^**                      | | |  |    |  |||| || |              
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ||||  |  |    ^***||| || ||  |       |  |                              | | ^***    |  |||| || |              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..***||  |  |    | | ||| || ||  |       |  |                              | |         |  |||| || |              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | ||  |  |    | ***** || ||  |       |  |                              | |         |  ||***** |              
search RasMol script viewer Motif-ligand binding stats  asxturn .. | ||  |  |    | | ||| || ||  |       |  |                              | |         |  |||| |***              
search RasMol script viewer Motif-ligand binding stats  betaturn .. | ||  ****    | ****| || |****       ****                              | |         |  ||****|                
search RasMol script viewer Motif-ligand binding stats  nest .. ***|  |  |    |   | | || ||  |                                         | |         |  || |  |                
search RasMol script viewer Motif-ligand binding stats  niche ..    *******    |   | **********                                         ***         ****| ****                
search RasMol script viewer Motif-ligand binding stats  stmotif ..               *****                                                                    | |                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                        ***                   

   New search    2iug:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML