triangle PDBeMotif: 2ig7  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.1.32
Classification transferase    | release date: Fri, Sep 22, 2006
Title crystal structure of human choline kinase b
Authors A.BOCHKAREV, A.M.EDWARDS, C.H.ARROWSMITH, G.WASNEY, H.PARK, J.WEIGELT, L.NEDYALKOVA, M.SUNDSTROM, M.VEDADI, R.LANDRY, STRUCTURAL GENOMICS CONSORTIUM (SGC), W.M.RABEH, W.TEMPEL
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search UNX UNX binding statistics UNX
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MGSSHHHHHHSSGLVPRGSVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGAWRRVQPEELRVYPV
SGGLSNLLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLK
TQELREPVLSAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQDLPPTGLPEMNLLEMYSLKDEMGNLRKLLESTPS
PVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIR
HYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSS
S
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CHOLINE/ETHANOLAMINE KINASE
member of: CATH:search3.10.450.110/search3.90.1200.10GENE3D:searchG3DSA_3.10.450.110/searchG3DSA_3.90.1200.10PANTHER:searchPTHR22603/searchPTHR22603_SF28PFAM:searchPF01633SUPERFAMILY:searchSSF56112UniProt:searchQ9Y259
JMol viewer RasMol script viewer  UNX 1015B  ..                                                                                                                                                                 ..UNX ..                                          ..                                                                                                                                    
JMol viewer RasMol script viewer  UNX 1024A  ..                                                                                                                                                                 ..UNX ..                                          ..                                                                                                                                    
JMol viewer RasMol script viewer  UNX 1016A  ..                                                                                                                                                                 ..UNX ..                                          ..                                                                                                                                    
JMol viewer RasMol script viewer  UNX 1013A  ..                                                                                                                                                                 ..UNX ..                                          ..                                                                                                                                    
JMol viewer RasMol script viewer  UNX 1012A  ..                                                                                                                                                                 ..UNX ..                                          ..                                                                                                                                    
JMol viewer RasMol script viewer  UNX 1011A  ..                                                                                                                                                                 ..UNX ..                                          ..                                                                                                                                    
JMol viewer RasMol script viewer  UNX 1009A  ..                                                                                                                                                                 ..UNX ..                                          ..                                                                                                                                    
JMol viewer RasMol script viewer  UNX 1007A  ..                                                                                                                                                                 ..UNX ..                                          ..                                                                                                                                    
JMol viewer RasMol script viewer  UNX 1004A  ..                                                                                                                                                                 ..UNX ..                                          ..                                                                                                                                    
sec str:  ..hhhhhhhhhhhhhhhhhhhhh......eeeee......eeeeee.............eeeeee.hhhhhhhhhhhhhhhhhhhhhhh.....eeeee..eeeee....ee.hhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh..... ...hhhhhhhhhhhhhhhhhhhhh....eeee....hhh.eee.....ee.hhhhheeeehhhhhhhhhhh..ee.........ee.hhhh.hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh.
sequence :  ..RDAERRAYQWCREYLGGAWRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQDLP... ..MNLLEMYSLKDEMGNLRKLLESTPSPVVFCHNDIQEGNILLL..SLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQLTS
seq num:  ..43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193        ... ..210       220       230       240         ..259       269       279       289       299       309       319       329       339       349       359       369       379         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|      |   |  |  || || |  |      ||  ||    |  | | | |||           |  |   |   |        ||||   ||                   |  |             |  |    | | ||   |       |  | ..PS00004.. | |  |||||       ||  |       | |  |  |   ..     ||| |         |  | || || || |      || || |   |         | || |  |  ||                             |  | ||                  |   |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|      |   |  |  || || |  |      ||  ||    |  | | | |||           |  |   |   |        ||||   ||                   |  |             |  |    | | ||   |       |  | ..PS00005.. | |  |^**|       ||  |       | |  |  |   ..     ||| |         |  | || || || |      || || |   |         | || |  |  ||                             |  | ||                  |   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|      |   |  |  || || |  |      ||  ||    ^*** | ^***|           |  |   |   |        ||||   ||                   |  |             |  |    | | ||   |       |  | ..PS00006.. | |  |^***       ||  |       | |  |  |   ..     ||| |         |  | || || ^***      || || |   |         | || |  ^***|                             |  ^***                  |   |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..*******^   |  |  || || |  |      ||  ||       | |   | |           |  |   |   |        ||||   ||                   |  |             |  |    | | ||   |       |  | ..PS00007.. | |  ||||        ||  |       | |  |  |   ..     ||| |         |  | || || || |      || || |   |         | || |  |   |                             |  | |                   |   |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  |  || || |  |      ^*****       | |   | |           |  |   |   |        ||||   ||                   |  |             |  |    | | ||   |       |  | ..PS00008.. | |  ||||        ||  |       | |  |  |   ..     ||| |         ^*****| || || |      || || |   |         | || |  |   |                             |  | |                   ^****
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |  |  ***** |  |       |  |        | |   | |           |  |   |   |        ||||   ||                   |  |             |  |    | | ||   |       |  | ..alphabetamotif.. | |  ||||        ||  |       | |  |  |   ..     ||| |            | || || || |      || || |   |         | || |  |   |                             |  | |                   |   |
search RasMol script viewer Motif-ligand binding stats  asxturn ..           |  |  || || |  |       |  |        | |   | |           |  |   |   |        ||||   ||                   |  |             |  |    | | ||   |       |  | ..asxturn.. ***  ||||        ||  |       | |  |  |   ..     ||| |            | || |***| |      || || |   |         | || |  |   |                             |  | |                   |   |
search RasMol script viewer Motif-ligand binding stats  betabulge ..           |  |  || || |  |       |  |        | |   | |           |  |   |   |        ||||   **                   |  |             |  |    | | ||   |       |  | ..betabulge..      ||||        ||  |       | |  |  |   ..     ||| |            | || ||  | |      || || |   |         | || |  |   |                             |  | |                   |   |
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |  |  ****| |  |       |  |        | |   | |           |  |   |   |        ||||                        |  |             ****    | | ||   |       |  | ..betaturn..      ||||        |****       | |  |  |   ..     ||| |            **** ||  | |      ****| |   |         | || |  |   |                             |  | |                   |   |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           |  |   |  | |  |       |  |        | |   | |           |  |   |   |        ||||                        |  |             |  |    | ***|   |       |  | ..gammaturn..      ||||        ||  |       | |  |  |   ..     ||| |              |  ||  | |       |  | |   |         | || |  |   |                             |  | |                   |   |
search RasMol script viewer Motif-ligand binding stats  nest ..           |  |   |  | |  |       |  |        | |   | |           |  |   |   |        ****                        |  |             |  |    | |  |   |       |  | ..nest..      ****        ||  |       ***  |  |   ..     *** |              |  ||  | |       |  | |   |         | || |  |   |                             |  | |                   |   |
search RasMol script viewer Motif-ligand binding stats  niche ..           ****   **** ****       ****        ***   ***           ****   |   |                                    ****             ****    ***  |   |       **** ..niche..                  |****            ****   ..      ****              **********       **** |   |         ******  |   |                             ******                   |   |
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                         |   |                                                                  |   |            ..stmotif..                  |   |                   ..                                              *****                 *****                                | |                   |   |
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                         *****                                                                  *****            ..ststaple..                  *****                   ..                                                                                                         | |                   *****
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                 ..stturn..                                          ..                                                                                                         ***                        

chain B : CHOLINE/ETHANOLAMINE KINASE
member of: CATH:search3.10.450.110/search3.90.1200.10GENE3D:searchG3DSA_3.10.450.110/searchG3DSA_3.90.1200.10PANTHER:searchPTHR22603/searchPTHR22603_SF28PFAM:searchPF01633SUPERFAMILY:searchSSF56112UniProt:searchQ9Y259
JMol viewer RasMol script viewer  UNX 1023B  ..                                                     ..                                                                                                            ..UNX ..                                                                                                                                                                                     
JMol viewer RasMol script viewer  UNX 1022B  ..                                                     ..                                                                                                            ..UNX ..                                                                                                                                                                                     
JMol viewer RasMol script viewer  UNX 1021B  ..                                                     ..                                                                                                            ..UNX ..                                                                                                                                                                                     
JMol viewer RasMol script viewer  UNX 1020B  ..                                                     ..                                                                                                            ..UNX ..                                                                                                                                                                                     
JMol viewer RasMol script viewer  UNX 1019B  ..                                                     ..                                                                                                            ..UNX ..                                                                                                                                                                                     
JMol viewer RasMol script viewer  UNX 1018B  ..                                                     ..                                                                                                            ..UNX ..                                                                                                                                                                                     
JMol viewer RasMol script viewer  UNX 1017B  ..                                                     ..                                                                                                            ..UNX ..                                                                                                                                                                                     
JMol viewer RasMol script viewer  UNX 1015B  ..                                                     ..                                                                                                            ..UNX ..                                                                                                                                                                                     
JMol viewer RasMol script viewer  UNX 1014B  ..          *                                          ..                                                                                                            ..UNX ..                                                                                                                                                                                     
JMol viewer RasMol script viewer  UNX 1010B  ..          |                                          ..                                                                                                            ..UNX ..                                                                                                                                                                                     
JMol viewer RasMol script viewer  UNX 1008B  ..          |                                          ..                                                                                                            ..UNX ..                                                                                                                                                                                     
JMol viewer RasMol script viewer  UNX 1006B  ..          |                                          ..                                                                                                            ..UNX ..                                                                                                                                                                                     
JMol viewer RasMol script viewer  UNX 1005B  ..          |                                          ..                                                                                                            ..UNX ..                                                                                                                                                                                     
JMol viewer RasMol script viewer  UNX 1003B  ..          |                                          ..                                                                                                            ..UNX ..                                                                                                                                                                                     
JMol viewer RasMol script viewer  UNX 1002B  ..          |                                          ..                                                                                                            ..UNX ..                                                                                                                                                                                     
JMol viewer RasMol script viewer  UNX 1001B  ..          |                                          ..                                                                                                            ..UNX ..                                                                                                                                                                                     
JMol viewer RasMol script viewer  UNX 1011A  ..          |                                          ..                                                                                                            ..UNX ..                                                                                                                                                                                     
sec str:  ..hhhhhhhhhhhhhhhhhhhhhh......eeee.......eeeeee.............eeeeee.hhhhhhhhhhhhhhhhhhhhhhh.....eeeee..eeeee...eee.hhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh...... ...hhhhhhhhhhhhhhhhhhhhh....eeee....hhh.eeee........eee......eeeehhhhhhhhhhh..ee.........ee.hhhh.hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh
sequence :  ..SRDAERRAYQWCREYLGGAWRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSV..EPREVLLRLYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQDLPP... ..MNLLEMYSLKDEMGNLRKLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQLTS
seq num:  ..42        52        62        72        82        92 ..97        107       117       127       137       147       157       167       177       187       197     ... ..210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..||  |   |   |  |   |  | |  |      ||  ||    | || | | ..            |  |   |   |        ||||   ||                   |  |             |  |    | |  |   |       |  |  ..PS00004.. |   ||||||       ||  |       | | || ||   |  || |     ||| |         |  | || || || |       |  | |   |         | || |  |  ||                             |  | ||                  |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..||  |   |   |  |   |  | |  |      ||  ||    | || | | ..            |  |   |   |        ||||   ||                   |  |             |  |    | |  |   |       |  |  ..PS00005.. |   ||^**|       ||  |       | | || ||   |  || |     ||| |         |  | || || || |       |  | |   |         | || |  |  ||                             |  | ||                  |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..||  |   |   |  |   |  | |  |      ||  ||    ^*** | ^*..            |  |   |   |        ||||   ||                   |  |             |  |    | |  |   |       |  |  ..PS00006.. |   ||^***       ||  |       | | || ||   ^***| |     ||| |         |  | || || ^***       |  | |   |         | || |  ^***|                             |  ^***                  |    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|*******^   |  |   |  | |  |      ||  ||      |  |   ..            |  |   |   |        ||||   ||                   |  |             |  |    | |  |   |       |  |  ..PS00007.. |   |||||        ||  |       | | || ||       | |     ||| |         |  | || || ||         |  | |   |         | || |  |   |                             |  | |                   |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|   |       |  |   |  | |  |      ^*****      |  |   ..            |  |   |   |        ||||   ||                   |  |             |  |    | |  |   |       |  |  ..PS00008.. |   |||||        ||  |       | | || ||       | |     ||| |         ^*****| || ||         |  | |   |         | || |  |   |                             |  | |                   ^****
search RasMol script viewer Motif-ligand binding stats  asxmotif ..|   |       |  |   |  | |  |       |  |       |  |   ..            |  |   |   |        ||||   ||                   |  |             |  |    | |  |   |       |  |  ..asxmotif.. *****||||        ||  |       | | || ||       | |     ||| |            | || || ||         |  | |   |         | || |  |   |                             |  | |                        
search RasMol script viewer Motif-ligand binding stats  asxturn ..|   |       |  |   |  | |  |       |  |       |  |   ..            |  |   |   |        ||||   ||                   |  |             |  |    | |  |   |       |  |  ..asxturn..      ||||        ||  |       | | || ||       ***     ||| |            | || |***|         |  | |   |         | || |  |   |                             |  | |                        
search RasMol script viewer Motif-ligand binding stats  betabulge ..|   |       |  |   |  | |  |       |  |       |  |   ..            |  |   |   |        ||||   **                   |  |             |  |    | |  |   |       |  |  ..betabulge..      ||||        ||  |       | | || ||       | |     ||| |            | || ||  |         |  | |   |         | || |  |   |                             |  | |                        
search RasMol script viewer Motif-ligand binding stats  betaturn ..|   |       |  |   |  | |  |       |  |       ****   ..            |  |   |   |        ||||                        |  |             ****    | |  |   |       ****  ..betaturn..      ||||        |****       | | ****|       | |     ||| |            **** ||  |         |  | |   |         | || |  |   |                             |  | |                        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|   |       |  |   |  | |  |       |  |       |  |   ..            |  |   |   |        ||||                        |  |             |  |    | |  |   |       |  |  ..gammaturn..      ||||        ||  |       | ***|  |       | |     ||| |              |  ||  |         |  | |   |         | || |  |   |                             |  | |                        
search RasMol script viewer Motif-ligand binding stats  nest ..|   |       |  |   |  | |  |       |  |       |  |   ..            |  |   |   |        ****                        |  |             |  |    | |  |   |       |  |  ..nest..      ****        ||  |       ***  |  |       | |     *** |              |  ||  |         |  | |   |         | || |  |   |                             |  | |                        
search RasMol script viewer Motif-ligand binding stats  niche ..|   |       ****   **** ****       ****       ****   ..            ****   |   |                                    ****             ****    ***  |   |       ****  ..niche..                  |****            ****       ***      ****              ********         **** |   |         ******  |   |                             ******                        
search RasMol script viewer Motif-ligand binding stats  stmotif ..*****                                                ..                   |   |                                                                  |   |             ..stmotif..                  |   |                                                                        *****                 *****                                | |                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                     ..                   *****                                                                  *****             ..ststaple..                  *****                                                                                                                                   | |                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                     ..                                                                                                            ..stturn..                                                                                                                                                          ***                        

   New search    2ig7:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors