triangle PDBeMotif: 2hzn  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.10.2
Classification transferase    | release date: Wed, Aug 9, 2006
Title abl kinase domain in complex with nvp-afg210
Authors D.FABBRO, G.FENDRICH, J.LIEBETANZ, P.MANLEY, S.W.COWAN-JACOB
Method X-RAY DIFFRACTION (resolution: 2.70Å)
PDBe Citation   
Small molecules:    search KIN KIN binding statistics KIN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GAMDPSSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLL
GVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADF
GLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPE
GCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKRGT
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF88PFAM:searchPF07714PFAMB:searchPB008186PRINTS:searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109, PROSITE PROFILES:searchPS50011, SMART:searchSM00219SUPERFAMILY:searchSSF55550/searchSSF56112UniProt:searchP00520
JMol viewer RasMol script viewer  KIN 600A  ..                          ..  *            * *  ..          *   *        *               ****                                        *          *        ****                                                                                                                        
sec str:  ...............hhh.eeeeee......eeeeeee.hhheeeeeee......hhhhhhhhhhhhh.........eeeee......eeeee.....hhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.hhh.eee...hhhhhh....eeee..eeee....hhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh........hhhhhhhhhhhhhhhh..
sequence :  ..MDPSSPNYDKWEMERTDITMKHKLGG..GEVYEGVWKKYSLTVAVKTL..DTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSI
seq num:  ..225       235       245   ..254       264       ..276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  |  ||  | || ||| |  | |.. |      **^*|    || ..             || || |  |   ||              |  |   ||||||| |       |   |   |  ||  || | | | ||||| |          ||||  |       |  |   |  |  |   | | | ||        |  ||| |     |    |    | |||    |  |   |  ||||||| ||||| |  |  | | |||   | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |  ||  | || ||^**  | |.. |      | |||    |^*..             || || |  |   ||              |  |   ||||||| |       |   |   |  ||  || | | | ||||| |          ||||  |       |  |   |  |  |   | | ^**|        |  ||| |     |    |    | |||    |  |   |  ||||||| ||^** |  |  | | |||   | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  |  ||  | || ||     | |.. |      | |||    |^*..             || || |  |   ||              |  |   ||||||| |       |   |   ^***|  || | | | ||||| |          ||||  |       |  |   |  ^***   | | |  |        |  ||| |     |    |    | |||    |  |   |  ||||||| || || ^***  | | |||   ^*
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |  ||  | || ||     | ^..**      | |||    |  ..             || || |  |   ||              |  |   ||||||| |       |   |       |  || | | | ||||| |          ||||  |       |  |   |  |      | | |  |        |  ||| |     ^*****    | |||    |  |   |  ||||||| || ||       | | |||     
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. |  |  ||  | || ||     |  ..        | |||    |  ..             || || |  |   ||              |  |   ||||||| |       |   |       |  || | | | ||||| |          ||||  |       |  |   |  |      | | |  |        |  ||| |               | |||    |  |   |  ||||||| || ||       | | |||     
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP .. |  |  ||  | || ||     ***..******************  ..             || || |  |   ||              |  |   ||||||| |       |   |       |  || | | | ||||| |          ||||  |       |  |   |  |      | | |  |        |  ||| |               | |||    |  |   |  ||||||| || ||       | | |||     
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_TYR .. |  |  ||  | || ||        ..        | |||       ..             || || |  |   ||              |  |   ||||||| |       |   |       |  || ****^********          ||||  |       |  |   |  |      | | |  |        |  ||| |               | |||    |  |   |  ||||||| || ||       | | |||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  |  ||  | || ||        ..        | |||       ..             ***** |  |   ||              |  |   *****|| |       |   |       ***** | | | *****            ||||  |       |  |   |  |      | | |  |        *****| |               | |||    |  |   *********| || ||       | *****     
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |  ||  | || ||        ..        | |||       ..             || || |  |   ||              |  |   ||||||***       |   |       |  || | | | |||||            ||||  |       |  |   |  |      | | |  |        |  | | |               | |||    |  |   |  ||||||| || ||       | | ||      
search RasMol script viewer Motif-ligand binding stats  betabulge .. |  |  ||  | || ||        ..        | |||       ..             || || |  |   **              |  |   ||||||          |   |       |  || | | | |||||            ||||  |       |  |   |  |      | | |  |        |  | | |               | |||    |  |   |  ||||||| || ||       | | ||      
search RasMol script viewer Motif-ligand binding stats  betaturn .. |  |  ||  | ****|        ..        ****|       ..             ****| |  |                   ****   *****|          |   |       ****| | | | ****|            ||||  |       ****   |  |      | | ****        **** | |               ****|    |  |   *********| ****|       | ****      
search RasMol script viewer Motif-ligand binding stats  nest .. |  |  ||  |  |  |        ..          ***       ..              |  | |  |                            |  |          |   |           *** ***  || |            ****  |              |  |      ***                  ***                 ***    |  |         |  | ||  |       |   |       
search RasMol script viewer Motif-ligand binding stats  niche .. ***********  ****        ..                    ..              **** ****                            ****          |   |                 |  ****               ****              ****                                                      ****         **********       |   |       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                          ..                    ..                                                                 *****                 |   |                                                                                                                           *****       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                          ..                    ..                                                                                       *   *                                                                                                                                       

   New search    2hzn:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors