triangle PDBeMotif: 2hwo  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.10.2
Classification transferase    | release date: Tue, Aug 1, 2006
Title crystal structure of src kinase domain in complex with coval inhibitor
Authors D.RAUH, J.A.BLAIR, K.M.SHOKAT
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Small molecules:    search GOL GOL binding statistics GOL   search RBS RBS binding statistics RBS
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GHMQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYA
VVSEEPIYIVTEYMSKGCLLDFLKGEMGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGL
ARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPEC
PESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF53PFAM:searchPF07714PRINTS:searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109, PROSITE PROFILES:searchPS50011, SMART:searchSM00219SUPERFAMILY:searchSSF55550/searchSSF56112UniProt:searchP00523
JMol viewer RasMol script viewer  RBS 1345A  ..                  * ..     *                  ..                        ..     *     **                                            *  *          *  ..                                                                                                             
sec str:  ..........hhh.eeeeeeee.....eeeeeeee...eeeeeeee........hhhhhhh.......eeeee.....eeee......hhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.hhh.eee......hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhh..........
sequence :  ..LAKDAWEIPRESLRLEVKLG..GCFGEVWMGTWNGTTRVAIKTLKP..FLQEAQVMKKLRHEKLVQLYAVVS..PIYIVTEYMSKGCLLDFLKGEMGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFG..PIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
seq num:  ..255       265       ..276       286       296 ..307       317       327 ..333       343       353       363       373       383       393       403 ..425       435       445       455       465       475       485       495       505       515       525      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  | || |||    | ..        | |^***|   || | ..       |  | |  |        ..                      |  |      |  ||          | | | | || || |         | |..||  |  |   | | | ||     || ||| ||||   |  |       || |||    |  |  |  |  || || ||  |              |  |  |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  | || ^**    | ..        | | |^**   |^** ..       |  | |  |        ..                      |  |      |  ||          | | | | || || |         | |..||  |  |   | | ^**|     || ||| ^**|   |  |       || |||    |  |  |  |  || || ||  |              |  |  |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  | || ||     | ..        | | |||    |    ..       |  | |  |        ..                      |  |      |  ||          | | | | || || |         | |..||  ^***   | | |  |     || ||| || |   |  |       || |||    |  |  ^***  || || ||  |              ^***  |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   |  | || ||     | ..        | | |||    |    ..       |  | |  |        ..                      |  |      |  ||          | | | | || || |         | |..||  |      | | |  |     || ||| || |   |  |       || |||    |  |        || || ||  |                 |  |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  | || ||     | ..        ^*****|    |    ..       |  | |  |        ..                      |  |      |  ||          | | | | || || |         | |..||  |      | | |  |     ^***** || |   |  |       || |||    |  |        || || ||  |                 |  |      
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..   |  | || ||     **..********************    ..       |  | |  |        ..                      |  |      |  ||          | | | | || || |         | |..||  |      | | |  |      | ||  || |   |  |       || |||    |  |        || || ||  |                 |  |      
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_TYR ..   |  | || ||       ..          | |||         ..       |  | |  |        ..                      |  |      |  ||          | ****^********         | |..||  |      | | |  |      | ||  || |   |  |       || |||    |  |        || || ||  |                 |  |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  | || ||       ..          | |||         ..       |  | |  |        ..                      |  |      *****          | | | | || ||           | |..||  |      | | |  |      | ||  || |   |  |       || |||    |  |        || || ||  |                 |  |      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..   |  | || ||       ..          *****         ..       |  | |  |        ..                      |  |      |  |           | | | | || ||           | |..||  |      | | |  |      | ||  || |   |  |       || |||    |  |        || || ||  |                 |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  | ****|       ..          ****|         ..       |  | |  |        ..                      |  |      ****           | | | | *****           | |..|****      | | ****      ****  || |   ****       |****|    |  |        ****| ||  |                 |  |      
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |  |  |       ..            ***         ..       |  | |  |        ..                      |  |                     *** ***  |  |           ***..||  |      ***             ||  |***   |  |       |  ***    |  |         |  | ||  |                 |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..   ****  ****       ..                        ..       **** ****        ..                      ****                           |  ****              ..|****                      ||  ||     ****       |    |    ****         **********                 ****      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                    ..                        ..                        ..                                                     |                    ..|   |                      ||  ||                ******                                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                    ..                        ..                        ..                                                     |                    ..*****                      ******                                                                            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                    ..                        ..                        ..                                                     *                    ..                                                                                                             

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF53PFAM:searchPF07714PRINTS:searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109, PROSITE PROFILES:searchPS50011, SMART:searchSM00219SUPERFAMILY:searchSSF55550/searchSSF56112UniProt:searchP00523
JMol viewer RasMol script viewer  GOL 100B  ..                   ..                    ..                                                                                              ..                                                                                     *  **                   
JMol viewer RasMol script viewer  RBS 1345B  ..               *   ..              *     ..                          * **  **                                            *  *          * ..                                                                                     |  ||                   
sec str:  .......hhh.eeeeeeee......eeeeee...eeeeee..................eeeee.....eeee......hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.hhh.eee.....hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhh..........
sequence :  ..DAWEIPRESLRLEVKLGQG..GEVWMGTWNGTTRVAIKTLK..QVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGCLLDFLKGEMGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADF..PIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
seq num:  ..258       268      ..279       289       ..312       322       332       342       352       362       372       382       392       402 ..425       435       445       455       465       475       485       495       505       515       525      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |  | ||| || |   ..     |  ^***|   || |.. || || |  |      | |                       |  |                  || ||| | |  |  | |           ..||  || ||| ||||| |||  | |  ||| |||| | || |        | |||    |  |  |  |   |  | || || |   |        |  |  |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  | ^** || |   ..     |   |^**   |^**.. || || |  |      | |                       |  |                  || ||| | |  |  | |           ..||  || ||| ||||^**||  | |  ||| ^**| | || |        | |||    |  |  |  |   |  | || || |   |        |  |  |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |  |  |  || |   ..     |   |||    |   .. || || |  |      | |                       |  |                  || ||| | |  |  | |           ..||  ^***|| ||||| |||  | |  ||| || | | || |        | |||    |  |  ^***   |  | || || |   |        ^***  |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|  |  |  |  || |   ..     |   |||    |   .. || || |  |      | |                       |  |                  || ||| | |  |  | |           ..||  ||  || ||||| |||  | |  ||| || | | || |        | |||    |  |         |  | || || |   |           |  |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |  |  |  || |   ..     ^*****|    |   .. || || |  |      | |                       |  |                  || ||| | |  |  | |           ..||  ||  || ||||| |||  | ^***** || | | || |        | |||    |  |         |  | || || |   |           |  |      
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..|  |  |  |  || ****..*****************   .. || || |  |      | |                       |  |                  || ||| | |  |  | |           ..||  ||  || ||||| |||  |    ||  || | | || |        | |||    |  |         |  | || || |   |           |  |      
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_TYR ..|  |  |  |  ||     ..         | |        .. || || |  |      | |                       |  |                  || ||****^********           ..||  ||  || ||||| |||  |    ||  || | | || |        | |||    |  |         |  | || || |   |           |  |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |  |  |  ||     ..         | |        .. || || |  |      | |                       |  |                  || ||| | |  |  |             ..||  |***** ||||| |||  |    ||  || | | || |        | |||    |  |         |  | ***** |   |           |  |      
search RasMol script viewer Motif-ligand binding stats  betabulge ..|  |  |  |  **     ..         | |        .. || || |  |      | |                       |  |                  || ||| | |  |  |             ..||  ||  |  ||||| |||  |    ||  || | | || |        | |||    |  |         |  | || || |   |           |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |  |  |         ..         | |        .. ****| |  |      | |                       |  |                  |****| | |  ****             ..||  |****  ||||****|  |    ||  || | | ****        ****|    |  |         |  | ***** |   |           |  |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |  |  |         ..         | |        ..  |  | |  |      | |                       |  |                  |  | | | |  |  |             ..||  |      |***| |||  |    ||  || | | || |          | |    |  |         |  | ||  | |   |           |  |      
search RasMol script viewer Motif-ligand binding stats  nest ..|  |  |  |         ..         ***        ..  |  | |  |      | |                       |  |                  |  *** ***  |  |             ..||  |      *** | |||  |    ||  |*** | || |          ***    |  |         |  | ||  | |   |           |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..****  ****         ..         ***        ..  **** ****      ***                       ****                  |    |   |  ****             ..|****          | |||  |    ||  ||   ******                 ****         ********** |   |           ****      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                   ..                    ..                                                                 ******   |                   ..|   |          | |||  |    ||  ||                                                  |   |                     
search RasMol script viewer Motif-ligand binding stats  stmotif ..                   ..                    ..                                                                          |                   ..|   |          *****  |    ||  ||                                                  *****                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                   ..                    ..                                                                          |                   ..*****          | |*****    ******                                                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                   ..                    ..                                                                          |                   ..               ***                                                                                           
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                   ..                    ..                                                                          *                   ..                                                                                                             

   New search    2hwo:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors