triangle PDBeMotif: 2hck  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.1.112
Classification transferase    | release date: Tue, Feb 25, 1997
Title src family kinase hck-quercetin complex
Authors F.SICHERI, I.MOAREFI, J.KURIYAN
Method X-RAY DIFFRACTION (resolution: 3.00Å)
PDBe Citation   
Small molecules:    search CA CA binding statistics CA   search QUE QUE binding statistics QUE
Modified residues:  search PTR PTR binding statistics PTR
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
EDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQL
LAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLS
VPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLV
KLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIA
DFGLARVGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYN
IMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HEMATOPOETIC CELL KINASE HCK
member of: CATH:search1.10.510.10/search2.30.30.40/search3.30.200.20/search3.30.505.10GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_2.30.30.40/searchG3DSA_3.30.200.20/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF181PFAM:searchPF00017/searchPF00018/searchPF07714PRINTS:searchSH2DOMAIN/searchSH3DOMAIN/searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109, PROSITE PROFILES:searchPS50001/searchPS50002/searchPS50011, SMART:searchSM00219/searchSM00252/searchSM00326SUPERFAMILY:searchSSF50044/searchSSF55550/searchSSF56112UniProt:searchP08631
JMol viewer RasMol script viewer  CA 1B  ..                                                                                                                                                                                                                                                                                                                                                                                                                                              *  *    
JMol viewer RasMol script viewer  QUE 1A  ..                                                                                                                                                                                             *       *           *                                            ****  *                                                *                                                                                                                        |  |    
JMol viewer RasMol script viewer  CA 2A  ..                                                                                                                                                                                             |       |           |                                            ||||  |                                                |                                                                                      *                                 |  |    
sec str:  .....eeee..................eeeeeee...eeeeee.....eeeeehhheee...hhh.........hhhhhhhh.........eeeee.......eeeeeeee.....eeeeeeee..................hhhhhhhhhh..............................hhheeeeee.eee..eeeeeeee...eeeeeeee......hhhhhhhhhhhhh..........eee....eeeee.......hhhhhh.hhhh...hhhhhhhhhhhhhhhhhhhh.........hhheee.....eee.............hhh..hhhhhh....hhhhhhhhhhhhhhhh.............hhhhhhh............hhhhhhhhhh....hhh...hhhhhhhhh.....hhh......
sequence :  ..EDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
seq num:  ..82        92        102       112       123       133       143       153       163       173       183       193       203       213       223       233       243       253       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       424       434       444       454       464       474       484       494       504       514       524     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..               | |   |  |               |  ^**|   || || |  |||||| | | |^**||  || | |||  |       ^** |   ^**|       ^**              ^**    |  ||   |  |||||         ^**        | | || ^**    ||                    |^** |||  |  ||  ||  |  |  |      | |             |  ||  |  |  |  | ||||||||||| || |||||   |  |  | || | |    | |         |  |  |   | | ^**||| | ||||| ||| |       | || || | |||    |  |   |  ||| ||| || ||   | | |||||  || |||     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..               | |   |  |               |  ^***   || || |  |||||| | | |^***|  || | |||  |        |  |   ^***                               ^***|   |  |||||                    | | || ||     ||                    |  | |||  |  ||  ||  |  |  |      | |             ^***|  |  |  |  | ||||||||||| || |||||   |  |  | || | |    | |         |  ^***   | | | |||| | ||||| ||| |       ^*** || | |||    |  |   |  ||| ||| || ||   | | ^***|  ^***||     
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..               | |   |  |               |  | |    || || |  |||||| | | ||   |  || | |||  |        |  |                                      |  ||   |  |||||                    | | || ||     ||                    |  | |||  |  ||  ||  |  |  |      | |             |  ||  |  |  |  | ||||||||||| || |||||   |  |  | || | |    | |         |  |      | | | |||| | ||||| ||| |         |  |******^    |  |   |  ||| ||| || ||   | | ||| |  ||  ||     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..               | |   |  |               |  | |    || || |  |||||| | | ||   |  || | ^*****        |  |                                      |  ||   |  |||||                    | | || ||     ||                    |  | |||  |  ||  ||  |  |  |      | |             |  ||  |  |  |  | ||||||||||| || |||||   |  |  | || | |    | |         |  |      | | | |||| | ||||| ||| |         |  |  | |||    |  |   |  ||| ||| || ||   | | ||| |  ||  ||     
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..               | |   |  |               |  | |    || || |  |||||| | | ||   |  || |  ||  |        |  |                                      |  ||   |  |||||                    | | || ||     ***********************  | |||  |  ||  ||  |  |  |      | |             |  ||  |  |  |  | ||||||||||| || |||||   |  |  | || | |    | |         |  |      | | | |||| | ||||| ||| |         |  |  | |||    |  |   |  ||| ||| || ||   | | ||| |  ||  ||     
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_TYR ..               | |   |  |               |  | |    || || |  |||||| | | ||   |  || |  ||  |        |  |                                      |  ||   |  |||||                    | | || ||     ||                       | |||  |  ||  ||  |  |  |      | |             |  ||  |  |  |  | ||||||||||| || ||||****^********| | |    | |         |  |      | | | |||| | ||||| ||| |         |  |  | |||    |  |   |  ||| ||| || ||   | | ||| |  ||  ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..               | |   |  |               |  | |    || || |  |||||| | | ||   ***** |  ||  |        |  |                                      *****   |  |||||                    | | || ||     ||                       | |||  *****  ||  |  |  |      | |             *****  |  |  |  ********************||   |  |  |  | | |    | |         |  |      | | *****| **********| |         |  |  | |||    |  |   *********| || ||   | ***** |  |*****     
search RasMol script viewer Motif-ligand binding stats  betabulge ..               | |   |  |               |  | |    || || |  |||||| | | ||   |  |  |  ||  |        |  |                                      |  |    |  |||||                    | | || ||     **                       | |||  |  |   ||  |  |  |      | |             |  ||  |  |  |  | ||||||||||  || |||||   |  |  |  | | |    | |         |  |      | | | || | | || || | | |         |  |  | |||    |  |   |  ||| ||| || ||   | | ||  |  ||  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..               | |   |  |               **** |    ****| |  |****| | | ||   ****  |  ||  |        ****                                      ****    |  |||||                    | | ****|                              ****|  ****   |****  ****      | |             ********  |  |  *********************|   |  ****  | | |    | |         |  |      | | ****** ********* | |         ****  ****|    |  |   *********| *****   | ****  ********      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               | |   |  |                  | |     |  | |  | |*** | | ||   |  |  |  ||  |                                                          |  ****|                    | |  |  |                                | |         |   |  |  |      | |             |   |  |  |  |                 |   | |   |  |  |  | | |    | |         |  |      | |    |   |     |   | |                 | |    |  |            | ||  |   |   |   |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..               | |   |  |                  ***     |  | |  | | || | | ||   |  |  |  ||  |                                                          |  ||  |                    | |  |  |                                ***         |   |  |  |      | |             |   |  |  |  |                 |   ***   |  |  |  | ***    ***         |  |      ***    |   |     |   ***                 ***    |  |            | ||  |   |   |   |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..               ***   ****                          **** **** ****** ***|   |  ***********                                                          ********                    ***  ****                                            |   |  ****      ***             |   ****  ****                 |         |  ****  | |                  ****             |   |     |   |                          ****            *******   |   |   ****          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                       *****                                                                                                                                                        |   |                            *****                          |         |        | |                                   |   |     |   |                                                    |   |                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                                                                                                    *****                                                           |         |        | |                                   *****     *****                                                    *****                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                                                                                    |         |        ***                                                                                                                            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                                                                    *         *                                                                                                                                       

chain B : HEMATOPOETIC CELL KINASE HCK
member of: CATH:search1.10.510.10/search2.30.30.40/search3.30.200.20/search3.30.505.10GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_2.30.30.40/searchG3DSA_3.30.200.20/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF181PFAM:searchPF00017/searchPF00018/searchPF07714PRINTS:searchSH2DOMAIN/searchSH3DOMAIN/searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109, PROSITE PROFILES:searchPS50001/searchPS50002/searchPS50011, SMART:searchSM00219/searchSM00252/searchSM00326SUPERFAMILY:searchSSF50044/searchSSF55550/searchSSF56112UniProt:searchP08631
JMol viewer RasMol script viewer  QUE 532B  ..                                                                                                                                                                                             **      *           *                                            ** *  *   *                                            *                                                                                                                                
JMol viewer RasMol script viewer  CA 1B  ..                                                                                                                                                                                             ||      |           |                                            || |  |   |                                            |                                                                                      *                                         
JMol viewer RasMol script viewer  CA 2A  ..                                                                                                                                                                                             ||      |           |                                            || |  |   |                                            |                                                                                      |                                 *  *    
sec str:  .....eeee..................eeeeeeee..eeeeee.....eeeeehhheee...hhh.........hhhhhhhh.........eeeee.......eeeeeeeee..eeeeeeeeeeeee...eee.........hhhhhhhhhh..............................hhheeeeee......eeeeeeeehh.eeeeeeee......hhhhhhhhhhhhh........eeeee....eeeee.......hhhhhh.hhhhh..hhhhhhhhhhhhhhhhhhhh.........hhheee.....eee.............hhh..hhhhhh....hhhhhhhhhhhhhhhh...........hhhhhhhhh............hhhhhhhhhh....hhh...hhhhhhhhh.....hhh......
sequence :  ..EDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
seq num:  ..82        92        102       112       123       133       143       153       163       173       183       193       203       213       223       233       243       253       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       424       434       444       454       464       474       484       494       504       514       524     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..              |  |   |  |               |  ^**|   || || |  ||  || | | |^**| ||| || |||  |     | ^** |   ^**| |  |  ^**      | ||| | ^**|   |  ||   |  || |          ^**        | | || ^**    ||           |  |     |^** ||||  |||  ||   |  |  |      | |         |  || ||||||| || |              |  ||| |||   | || || |  | |    | |     | | |  |  |   | | ^**||  |    ||||||||   |  || || || ||| |    |  |    | ||||  | |       | |||||||  || ||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              |  |   |  |               |  ^***   || || |  ||  || | | |^*** ||| || |||  |     |  |  |   ^*** |  |           | ||| | |  |   ^***|   |  || |                     | | || ||     ||           |  |     |  | ||||  |||  ||   |  |  |      | |         |  |^***||||| || |              |  ||| |||   | || || |  | |    | |     | | |  ^***   | | |  ||  |    ||||||||   |  |^*** || ||| |    |  |    | ||||  | |       | ||^***|  ^***|      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..              |  |   |  |               |  |||    || || |  ||  || | | |  |  ||| || |||  |     |  |  |        |  |           | ||| | |  |   |  ||   |  || |                     | | || ||     ||           |  |     |  | ||||  |||  ||   |  |  |      | |         |  |  | ||||| || |              |  ||| |||   | || || |  | |    | |     | | |  |      | | |  ||  |    ||||||||   |  |  |  |******^    |  |    | ||||  | |       | ||||| |  ||  |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              |  |   |  |               |  |||    || || |  ||  || | | |  |  ||| || ^*****     |  |  |        |  |           | ||| | |  |   |  ||   |  || |                     | | || ||     ||           |  |     |  | ||||  |||  ||   |  |  |      | |         |  |  | ||||| || |              |  ||| |||   | || || |  | |    | |     | | |  |      | | |  ||  |    ||||||||   |  |  |  || ||| |    |  |    | ||||  | |       | ||||| |  ||  |      
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..              |  |   |  |               |  |||    || || |  ||  || | | |  |  ||| ||  ||  |     |  |  |        |  |           | ||| | |  |   |  ||   |  || |                     | | || ||     ***********************  | ||||  |||  ||   |  |  |      | |         |  |  | ||||| || |              |  ||| |||   | || || |  | |    | |     | | |  |      | | |  ||  |    ||||||||   |  |  |  || ||| |    |  |    | ||||  | |       | ||||| |  ||  |      
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_TYR ..              |  |   |  |               |  |||    || || |  ||  || | | |  |  ||| ||  ||  |     |  |  |        |  |           | ||| | |  |   |  ||   |  || |                     | | || ||     ||           |  |        | ||||  |||  ||   |  |  |      | |         |  |  | ||||| || |              |  ||| ||****^********  | |    | |     | | |  |      | | |  ||  |    ||||||||   |  |  |  || ||| |    |  |    | ||||  | |       | ||||| |  ||  |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              |  |   |  |               *****|    || || |  ||  || | | |  *****| ||  ||  |     |  |  |        |  |           | ||| | |  |   *****   |  || |                     | | || ||     ||           |  |        | |||**********   |  |  |      | |         |  |  *****|| || |              *****| |||   | || ||    | |    | |     | | |  |      | | *****  |    *****|||   |  |  |  |***** |    |  |    *****|  | |       ******* |  ||  |      
search RasMol script viewer Motif-ligand binding stats  betabulge ..              |  |   |  |               |  | |    || || |  ||  || | | |  |  ||| ||  ||  |     |  |  |        |  |           | ||| | |  |   |  |    |  || |                     | | || ||     **           |  |        | ||||  | |  ||   |  |  |      | |         |  |  | || || || |              |  ||| |||   | || ||    | |    | |     | | |  |      | | |  |   |    |||| |||   |  |  |  || ||| |    |  |    | || |  | |       | || |  |  ||  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..              |  |   |  |               **** |    ****| |  ||  || | | |  *********  ||  |     |  |  |        ****           ****| | |  |   ****    |  || |                     | | *****                  ****        ****|**** ****|   |  ****      | |         ****  ********** |              ****|****|   | ****|    | |    | |     | | |  |      | | ****   |    *******|   |  |  ********| |    |  |    ******  | |       ******  ********      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              |  |   |  |                  | |     |  | |  ||  || | | |       |  |  ||  |     |  |  |        |  |             | | | |  |           |  |***                     | |  |  |                                | |         |   |  |  |      | |                 |  |  |  |                 ||  | |   |  |  |    | |    | |     | | |  |      | |    |   |     ||  | |   |  |          | |    |  |            | |               |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..              |  |   |  |                  ***     |  | |  ||  || | | |       |  |  ||  |     |  |  |        |  |             *** | |  |           |  |                        | |  |  |                                ***         |   |  |  |      | |                 |  |  |  |                 ||  ***   |  |  |    ***    ***     | | |  |      ***    |   |     ||  ***   |  |          ***    |  |            | |               |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..              ****   ****                          **** *********** ***       ***********     *******        ****                 ******           ****                        ***  ****                                            |   |  ****      ***                 ****  ****                 ||    |   |  ****                   *** ****             |   |     ||  | |   ****                 ****            ***               ****          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                                                                                                                                                    |   |                                                           |******   |                                              |   |     |******                                                                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                                                                                                    *****                                                           |         |                                              *****     *****                                                                          
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                                                                    *         *                                                                                                                                       

   New search    2hck:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML