triangle PDBeMotif: 2gh5  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.8.1.7
Classification oxidoreductase    | release date: Sat, Mar 25, 2006
Title crystal structure of human glutathione reductase complexed w fluoro-analogue of the menadione derivative m5
Authors A.WINZER, E.DAVIOUD-CHARVET, H.BAUER, H.SCHIRMER, K.FRITZ-WOLF
Method X-RAY DIFFRACTION (resolution: 1.70Å)
PDBe Citation   
Small molecules:    search ELI ELI binding statistics ELI   search PO4 PO4 binding statistics PO4   search GOL GOL binding statistics GOL   search FAD FAD binding statistics FAD
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
ACRQEPQPQGPPPAAGAVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMH
DHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMP
STPHESQIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELEN
AGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQN
TNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIENVKTYS
TSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GLUTATHIONE REDUCTASE, MITOCHONDRIAL
member of: GENE3D:searchG3DSA_3.30.390.30/searchG3DSA_3.50.50.60PANTHER:searchPTHR22912/searchPTHR22912_SF27PFAM:searchPF00070/searchPF02852/searchPF07992PRINTS:searchFADPNR/searchPNDRDTASEIPROSITE PATTERNS:searchPS00076, SUPERFAMILY:searchSSF51905/searchSSF55424TIGRFAMS:searchTIGR01421UniProt:searchP00390
JMol viewer RasMol script viewer  GOL 811B  ..                                                                                                                                                                                                                                                                                                                                                                                                                                                                            *
JMol viewer RasMol script viewer  GOL 806B  ..                                                                                                                                                                                                                                                                                                                                     *                                                                                                                                      |
JMol viewer RasMol script viewer  FAD 479B  ..                                                                                                                                                                                                                                                                                                                                     |                                                                                                                           **         |
JMol viewer RasMol script viewer  ELI 958B  ..                                                                                                                                                                                                                                                                                                                                     |                                                                                                                           *|         |
JMol viewer RasMol script viewer  GOL 817A  ..                                                           *                                                                                                                                                                                                                                                                         |                              *                                      * *                      *                            ||         |
JMol viewer RasMol script viewer  GOL 813A  ..                                                           |                                                                                                                                                                                                                                                                         |   *                          |                                      | |                      |                            ||         |
JMol viewer RasMol script viewer  GOL 810A  ..                                                           |                                                                                                                                                                                                                                                                         |   |                          |                            **        | |                      |                            ||         |
JMol viewer RasMol script viewer  GOL 809A  ..                                                           |                 * *                                                                                                                                                                                                                                                     |   |                          |                            ||        | |                      |                            ||         |
JMol viewer RasMol script viewer  GOL 808A  ..                                                           |                 | |                                                                                                 **                                                                                           **                                                     |   |                          |                            ||        | |                      |                            ||         |
JMol viewer RasMol script viewer  FAD 479A  ..        ** ***                 ****   ***   **  *          |                 | |                              ***                        ***                   *                 ||**                                                                                         || *                                      **     ****  |   |                          |                            ||        | |                      |                            ||         |
JMol viewer RasMol script viewer  ELI 958A  ..        || |***  *           ||||  *||**  ||  |          |                 | |            *   *             |||                        |||                   |                 ||||                                                                                         || |                                      ||     ||*|  |   *                          |                            ||        | |                      |                            ||         |
JMol viewer RasMol script viewer  PO4 5706A  ..        || ||| ||  |           ||||  |||||  ||  |          |                 | |            |   |             |||                        |||                   |                 ||||                   **    *                                                               || |                                      ||     ||||  |   |                          |                            ||        | |                      |                            ||         |
JMol viewer RasMol script viewer  PO4 5703A  ..        || ||| ||  |           ||||  |||||  ||  |          |                 | |            |   |             |||                        |||                   |                 ||||                   **    |                                                               || |                                      ||     ||||  |   |                          |                            ||        | |                      |                            ||         |
sec str:  ...ee..eeee..hhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhh..eeee..eee......eeee..eeee...eee...eee.........hhhhh.hhhhhh.......eeeee..hhhhhhhhhhhhhh..eeeee..........hhhhhhhhhhhhhhh..eee..eeeeeeee....eeeeeee.......eeeeeeee.eeee...eee.....hhhhh......................eee.hhhhh...hhhhhhhhhhhhhhhhhh.............eee.....eeeee.hhhhhhhhhh...eeeeeeee.hhhhhhh.....eeeeeeee....eeeeeeee..hhhhhhhhhhhhhhh..hhhhhhh.......hhhhhhh..
sequence :  ..VASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMHDHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
seq num:  ..18        28        38        48        58        68        78        88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |     |  | |  | |  | |||   |  | |||| |  | | || |   |            | |   | ||| |                || ^***||||        | | |    |||||||        |    |  |  | ||||||| ||| ||          | ||   |  |    |||   |       | ||| | | ^***    | |               || |  |   |  |                         |||| |||  | | |   | | || |  |    | |||| |      |  |      | |  |  ||| |               |  |     || ||         | || |||||           | | ||      | |        || ||||  ||  | | | |  | | |||
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   |     |  | |  | |  | |||   |  | |||| |  | | || |   |            | |   | ||| |                || ||| ||||        | | |    |||**^*        |    |  |  | ||||||| ||| ||          | ||   |  |    |||   |       | ||| | |   |     | |               || |  |   |  |                         |||| |||  | | |   | | || |  |    | |||| |      |  |      | |  |  ||| |               |  |     || ||         | || |**^*           | | ||      | |        || ||||  ||  | | | |  | | |||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |     |  | |  ^**  | |||   |  ^**||| |  | | || |   |            | |   | ||| |                || ||| ||||        | | |    |^**|          |    |  |  | ||||||| ||| ||          | ||   |  |    |||   |       | ||| | |   |     | |               || |  |   |  |                         |||| |||  | | |   | | || |  |    | |||| |      |  |      | |  |  ||| |               |  |     || ||         | || ^**             | | ||      | |        || ||||  ||  | | | |  | | ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |     |  | |       | |||   |    |||| |  | | || |   |            | |   | ||| |                || ||| ^***        | | |    ||| |          |    ^***  | ||||||| ||| ||          | ||   |  |    |||   |       | ||| | |   |     | |               ^***  |   |  |                         |||| |||  | | |   | | || |  |    | |||| |      |  |      | |  ^***|| |               ^***     || ||         | || | |             | | ||      | |        || |||^***|  | | | ^*** | || 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..****     ^*****       | |^*****    |||^***** | || |   |            | |   | ||| |                || ||| |||         | | |    ||| |          ^*****     | ^*****| ||| ||          | ||   |  ^*****^*****       | ||| | |   |     | |                ^*****   |  |                         |||| |||  | | |   | | || |  |    | |||| |      |  |      | |  |  ||| |                        || ||         | || | |             | | ||      | |        || |^*****|  | | |    | | || 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..            |         | |||        |||| |    | || |   |            | |   | ||| |                || ||| |||         | | |    |^***                     | ||||| | ||| ||          | ||   |       | |           | ||| | |   |     | |                         |  |                         |||| |||  | | |   | | || |  |    | |||| |      ^***      | |  |  ||| |                        || ||         | || | |             | | ||      | |        || |||   ||  | | |    | | || 
search RasMol script viewer Motif-ligand binding stats  PYRIDINE_REDOX_1 ..            |         | |||        ||***^****^**| |   |            | |   | ||| |                || ||| |||         | | |    | |                       | ||||| | ||| ||          | ||   |       | |           | ||| | |   |     | |                         |  |                         |||| |||  | | |   | | || |  |    | |||| |                | |  |  ||| |                        || ||         | || | |             | | ||      | |        || |||   ||  | | |    | | || 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            |         | |||        || | |    |  | |   |            | |   | ||| |                *****| |||         | | |    | |                       | ||||| | ||| ||          | ||   |       | |           | ||| | |   |     | |                         |  |                         |||| |||  | | |   | | || |  |    | |||| |                | |  |  ||| |                        || ||         | || | |             | | ||      | |        || |||   ||  | | |    | | || 
search RasMol script viewer Motif-ligand binding stats  asxturn ..            |         | |||        || | |    |  | |   |            | |   | ||***                || | | |||         | | |    | |                       | ||||| | ||| ||          | ||   |       | |           | ||*** |   |     | |                         |  |                         |||| |||  *** |   *** || |  |    | |||| |                | |  |  ||| |                        || ||         | || | |             | | ||      | |        || |||   ||  | | |    | | || 
search RasMol script viewer Motif-ligand binding stats  betabulge ..            |         | |||        || | |    |  | |   |            | |   | ||                   || | | |||         | | |    | |                       | ||||| | ||| ||          | ||   |       | |           | ||    |   |     | |                         |  |                         |||| |||    | |     | || |  |    | |||| |                | |  |  ||| |                        || ||         | || | |             | | **      | |        || |||   ||  | | |    | | || 
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |         ****|        **** |    |  | |   |            | |   | ||                   **** ****|         | | |    | |                       ******| | |****|          | ||   |       | |           ****    |   |     | |                         ****                         |||****|    | |     | || ****    ****|| |                | |  |  ||| |                        ****|         **** | |             | |         | |        |****|   ||  | | |    | | || 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            |           | |         | | |    |  | |   |            | |   | ||                    |   | | |         | | |    ***                         ||| | | |||  |          | ||   |       | |           | ||    |   |     | |                         |  |                         |||| | |    | |     | || |  |      | |***                | |  |  ||| |                         |  |           |  | |             | |         | |        |  | |   ||  | | |    | | || 
search RasMol script viewer Motif-ligand binding stats  nest ..            |           ***         | | |    |  | |   |            ***   ***|                    |   | ***         | | |                                *** | | |||  |          | ||   |       ***           ***|    |   |     ***                         |  |                         **** ***    ***     ***| |  |      ***                   ***  |  ||| |                         |  |           |  | |             ***         ***        |  ***   ||  | | |    | | || 
search RasMol script viewer Motif-ligand binding stats  niche ..            |                       *** |    |  | |   |                     |                    |   |             *****                                 **** | ||****          ***|   |                     ****    |   |                                 ****                                                | ****                              ****  *****                         ****           ******                                    |    |   |**** | |    | **** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..            |                           |    |  | |   |                     |                    |   |                                                        | ||                 |   |                             |   |                                                                                     | |                                                                                                                              ******   |   | | |    |   |  
search RasMol script viewer Motif-ligand binding stats  ststaple ..            |                           |    |  | *****                     |                    *****                                                        | ||                 |   |                             *****                                                                                     | |                                                                                                                                       ***** | |    *****  
search RasMol script viewer Motif-ligand binding stats  stturn ..            |                           |    |  |                           |                                                                                 ***|                 |   |                                                                                                                       ***                                                                                                                                             | |    |      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..            *                           *    *  *                           *                                                                                    *                 *   *                                                                                                                                                                                                                                                                       * *    *      

chain B : GLUTATHIONE REDUCTASE, MITOCHONDRIAL
member of: GENE3D:searchG3DSA_3.30.390.30/searchG3DSA_3.50.50.60PANTHER:searchPTHR22912/searchPTHR22912_SF27PFAM:searchPF00070/searchPF02852/searchPF07992PRINTS:searchFADPNR/searchPNDRDTASEIPROSITE PATTERNS:searchPS00076, SUPERFAMILY:searchSSF51905/searchSSF55424TIGRFAMS:searchTIGR01421UniProt:searchP00390
JMol viewer RasMol script viewer  GOL 812B  ..                                                           **                                                                                                                                                                                                                                                                                                       **                                     *                        *                                        
JMol viewer RasMol script viewer  GOL 811B  ..                                                           ||                                                                                                                                                                                                                                                                            *                          ||                                     |                        |                                        
JMol viewer RasMol script viewer  GOL 806B  ..                                                           ||                                                                                                                                                                                                                                                                            |                          ||                                     |                        |                            *    *      
JMol viewer RasMol script viewer  GOL 805B  ..                                                           ||                                                                                                                                                                                                                                                                            |                          ||                            *        |                        |                            |    |      
JMol viewer RasMol script viewer  GOL 803B  ..                                                           ||                                                                                                                    *                           ****                                                                                                                        |                          ||                            |        |                        |                            |    |      
JMol viewer RasMol script viewer  GOL 802B  ..                                    *                      ||                                                *                                                                   |                           ||||                                                                                                                        |                          ||                            |        |                        |                            |    |      
JMol viewer RasMol script viewer  GOL 801B  ..                                    |                      ||                                                |                                                                   |                           |||| **  *                                                                                                                  |                          ||                            |        |      *                 |                            |    |      
JMol viewer RasMol script viewer  FAD 479B  ..         *****                 **** | **    **  *          ||                                                |***                        ***                                     | **                        |||| ||  |                                                          *      *                               **     ****      |                          ||                            |        |      |                 |                            |    |      
JMol viewer RasMol script viewer  ELI 958B  ..         |||*|  *  *           |||| |*||**  ||  |          ||                               *   *            ||||                        |||                                     | ||                        |||| ||  |                                                          |      |                               ||     ||*|      *                          ||                            |        |      |                 |                            |    |      
JMol viewer RasMol script viewer  PO4 5705B  ..         |||||  |  |           |||| ||||||  ||  |          ||                               |   |            ||||                        |||                                     | ||                   **   |*|| ||  |                                                          |      |                               ||     ||||      |                          ||                            |        |      |                 |                            |    |      
JMol viewer RasMol script viewer  PO4 5704B  ..         |||||  |  |           |||| ||||||  ||  |          ||                               |   |            ||||                        |||                                     | ||                   **   |||| ||  |                                                          |      |                               ||     ||||      |                          ||                            |        |      |                 |                            |    |      
JMol viewer RasMol script viewer  GOL 813A  ..         |||||  |  |           |||| ||||||  ||  |          ||                               |   |            ||||                        |||                                     | ||                   ||   |||| ||  |                                                          |      |                               ||     ||||      |                          ||                            |        |      |                 |                            |    |      
JMol viewer RasMol script viewer  FAD 479A  ..         |||||  |  |           |||| ||||||  ||  |          ||                               |   |            ||||                        |||                                     | ||                   ||   |||| ||  |                                                          |      |                               ||     ||||      |                          ||                            |        |      |                 |                            **   |      
JMol viewer RasMol script viewer  ELI 958A  ..         |||||  |  |           |||| ||||||  ||  |          ||                               |   |            ||||                        |||                                     | ||                   ||   |||| ||  |                                                          |      |                               ||     ||||      |                          ||                            |        |      |                 |                            *|   |      
sec str:  ...ee..eeee..hhhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhh..eeee..eee......eeee..eeee...eee...eee.........hhhhh.hhhhhh.......eeeee..hhhhhhhhhhhhhh..eeeee..........hhhhhhhhhhhhhhh..eee..eeeeeeeee..eeeeeeee.......eeeeeeee.eeee...eee.....hhhhhh.....................eee.hhhhh...hhhhhhhhhhhhhhhhhhh............eee.....eeeee.hhhhhhhhhh...eeeeeeee.hhhhhhh.....eeeeeeee....eeeeeeee..hhhhhhhhhhhhhhh..hhhhhhh.......hhhhhhh..
sequence :  ..VASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMHDHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
seq num:  ..18        28        38        48        58        68        78        88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |     |  | |  | |    |||   |  | | || |  | | || |   |     |  |   | |      |                   || ^***| ||                  | ||||        |    | || || ||||||| ||| ||             |   |  |    |||   |       | ||    | ^***    | |             | || |  |   |  |      |  |               |||| | |    | |   | | || |  |    | |||| |      |  |        |  |  ||| |               |  |     || ||         | || |||||           | | ||      | |        || ||||  ||  | | | |  | | |||
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   |     |  | |  | |    |||   |  | | || |  | | || |   |     |  |   | |      |                   || ||| | ||                  | **^*        |    | || || ||||||| ||| ||             |   |  |    |||   |       | ||    |   |     | |             | || |  |   |  |      |  |               |||| | |    | |   | | || |  |    | |||| |      |  |        |  |  ||| |               |  |     || ||         | || |**^*           | | ||      | |        || ||||  ||  | | | |  | | |||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |     |  | |  ^**    |||   |  ^** || |  | | || |   |     |  |   | |      |                   || ||| | ||                  ^**|          |    | || || ||||||| ||| ||             |   |  |    |||   |       | ||    |   |     | |             | || |  |   |  |      |  |               |||| | |    | |   | | || |  |    | |||| |      |  |        |  |  ||| |               |  |     || ||         | || ^**             | | ||      | |        || ||||  ||  | | | |  | | ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |     |  | |         |||   |      || |  | | || |   |     |  |   | |      |                   || ||| ^***                  |  |          |    ^*** || ||||||| ||| ||             |   |  |    |||   |       | ||    |   |     | |             | ^***  |   |  |      |  |               |||| | |    | |   | | || |  |    | |||| |      |  |        |  ^***|| |               ^***     || ||         | || | |             | | ||      | |        || |||^***|  | | | ^*** |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..****     ^*****         |^*****      |^***** | || |   |     |  |   | |      |                   || ||| | |                   |  |          ^***** || || ^*****| ||| ||             |   |  ^*****^*****       | ||    |   |     | |             | |^*****   |  |      |  |               |||| | |    | |   | | || |  |    | |||| |      |  |        |  |  ||| |                        || ||         | || | |             | | ||      | |        || |^*****|  | | |    | |  | 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..            |           | |          |  |    | || |   |     |  |   | |      |                   || ||| | |                   ^***                 || || ||||| | ||| ||             |   |       | |           | ||    |   |     | |             | |         |  |      |  |               |||| | |    | |   | | || |  |    | |||| |      ^***        |  |  ||| |                        || ||         | || | |             | | ||      | |        || |||   ||  | | |    | |  | 
search RasMol script viewer Motif-ligand binding stats  PYRIDINE_REDOX_1 ..            |           | |          ***^****^**| |   |     |  |   | |      |                   || ||| | |                                        || || ||||| | ||| ||             |   |       | |           | ||    |   |     | |             | |         |  |      |  |               |||| | |    | |   | | || |  |    | |||| |                  |  |  ||| |                        || ||         | || | |             | | ||      | |        || |||   ||  | | |    | |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            |           | |             |    |  | |   |     |  |   | |      |                   *****| | |                                        ***** ||||| | ||| ||             |   |       | |           | ||    |   |     | |             | |         |  |      |  |               |||| | |    | |   | | || |  |    | |||| |                  |  |  ||| |                        || ||         | || | |             | | ||      | |        || |||   ||  | | |    | |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..            |           | |             |    |  | |   |     |  |   | |      |                   || | | | |                                        || || ||||| | ||| ||             |   |       | |           | ||    |   |     | |             | |         |  |      |  |               |||| | |    | |   *** || |  |    | |||| |                  |  |  *** |                        || ||         | || | |             | | ||      | |        || |||   ||  | | |    | |  | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..            |           | |             |    |  | |   |     |  |   | |      |                   || | | | |                                        || || ||||| | ||| ||             |   |       | |           | ||    |   |     | |             | |         |  |      |  |               |||| | |    | |     | || |  |    | |||| |                  |  |  ||| |                        || ||         | || | |             | | **      | |        || |||   ||  | | |    | |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |           | |             |    |  | |   |     ****   | |      |                   **** | | |                                        **********| | |****|             |   |       | |           | ||    |   |     | |             | |         ****      |  |               |||| | |    | |     | || ****    ****|| |                  ****  ||| |                        ****|         **** | |             | |         | |        |****|   ||  | | |    | |  | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            |           | |             |    |  | |   |            | |      |                    |   | | |                                         |  | ||| | | |||  |             |   |       | |           | ||    |   |     | |             | |         |  |      |  |               |||| | |    | |     | || |  |      | |***                  |  |  ||| |                         |  |           |  | |             | |         | |        |  | |   ||  | | |    | |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..            |           ***             |    |  | |   |            ***      |                    |   | ***                                         |  | *** | | |||  |             |   |       ***           ***|    |   |     ***             | |         |  |      |  |               **** ***    ***     ***| |  |      ***                     |  |  ||| |                         |  |           |  | |             ***         ***        |  ***   ||  | | |    | |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..            |                           |    |  | |   |                     |                    |   |                                             ****  **** | ||****             |   |                     ****    |   |                     | |         ****      ****                                      | ****                              ****  *****                         ****           ******                                    |    |   |**** | |    | **** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..            |                           |    |  | |   |                     |                    |   |                                                        | ||                 |   |                             |   |                     | |                                                             | |                                                                                                                              ******   |   | | |    |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..            |                           |    |  | *****                     |                    *****                                                        | ||                 |   |                             *****                     | |                                                             | |                                                                                                                                       ***** | |    |      
search RasMol script viewer Motif-ligand binding stats  stturn ..            |                           |    |  |                           |                                                                                 ***|                 |   |                                                       ***                                                             ***                                                                                                                                             | |    |      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..            *                           *    *  *                           *                                                                                    *                 *   *                                                                                                                                                                                                                                                                       * *    *      

   New search    2gh5:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors