triangle PDBeMotif: 2gb0  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.5.3.1
Classification oxidoreductase    | release date: Thu, Mar 9, 2006
Title monomeric sarcosine oxidase: structure of a covalently flavi amine oxidizing enzyme
Authors F.S.MATHEWS, M.A.WAGNER, M.S.JORNS, P.TRICKEY
Method X-RAY DIFFRACTION (resolution: 1.85Å)
PDBe Citation   
Small molecules:    search PO4 PO4 binding statistics PO4   search FAD FAD binding statistics FAD   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
STHFDVIVVGAGSMGMAAGYQLAKQGVKTLLVDAFDPPHTNGSHHGDTRIIRHAYGEGREYVPLALRSQELWYELEKETH
HKIFTKTGVLVFGPKGESAFVAETMEAAKEHSLTVDLLEGDEINKRWPGITVPENYNAIFEPNSGVLFSENCIRAYRELA
EARGAKVLTHTRVEDFDISPDSVKIETANGSYTADKLIVSMGAWNSKLLSKLNLDIPLQPYRQVVGFFESDESKYSNDID
FPGFMVEVPNGIYYGFPSFGGCGLKLGYHTFGQKIDPDTINREFGVYPEDESNLRAFLEEYMPGANGELKRGAVCMYTKT
LDEHFIIDLHPEHSNVVIAAGFSGHGFKFSSGVGEVLSQLALTGKTEHDISIFSINRPALKESLQKTTI
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MONOMERIC SARCOSINE OXIDASE
member of: CATH:search3.30.9.10/search3.50.50.60GENE3D:searchG3DSA_3.30.9.10/searchG3DSA_3.50.50.60HAMAP:searchMF_00516PANTHER:searchPTHR10961/searchPTHR10961_SF8PFAM:searchPF01266SUPERFAMILY:searchSSF51905/searchSSF54373TIGRFAMS:searchTIGR01377UniProt:searchP40859
JMol viewer RasMol script viewer  FAD 400A  ..         * ***                 ****   *  ***    **                                                                                                                        ***                          *** *   *                *                            *                                                            ***                        * *****                                       
JMol viewer RasMol script viewer  CL 803A  ..         | |||                 ||||   |  |||    ||                                                                                                                        |||                          ||| |   |                |                            |                                                            ||**                       ***||||                                       
JMol viewer RasMol script viewer  PO4 801A  ..         | |||                 ||||   |  |||    ||                              *                                                                     *  *                |||                          ||| |   |                |                            |                                                            ||||                       |||||||                                       
sec str:  ....eeeeeee..hhhhhhhhhhhhhh...eeee...............eeee........hhhhhhhhhhhhhhhhhhhh....ee...eeeeee...hhhhhhhhhhhhhh....eeeehhhhhhhh........eeeeee...eeeehhhhhhhhhhhhhhh..eee....eeeeeee..eeeeee..eeeeeeeeee.hhhhhhhhhhhh.ee...eeeeeeeeee..hhhhhhhhhh..eeeeee..eeeeee.......eeeee....ee.............hhhhhhhhhhhhhhhhhhh..eeeeeeeeeee......eeeee..eeeeeeee.....hhhhhhhhhhhhhhhhhhh.....hhhhh..hhhhh.ee...
sequence :  ..STHFDVIVVGAGSMGMAAGYQLAKQGVKTLLVDAFDPPHTNGSHHGDTRIIRHAYGEGREYVPLALRSQELWYELEKETHHKIFTKTGVLVFGPKGESAFVAETMEAAKEHSLTVDLLEGDEINKRWPGITVPENYNAIFEPNSGVLFSENCIRAYRELAEARGAKVLTHTRVEDFDISPDSVKIETANGSYTADKLIVSMGAWNSKLLSKLNLDIPLQPYRQVVGFFESDESKYSNDIDFPGFMVEVPNGIYYGFPSFGGCGLKLGYHTFGQKIDPDTINREFGVYPEDESNLRAFLEEYMPGANGELKRGAVCMYTKTLDEHFIIDLHPEHSNVVIAAGFSGHGFKFSSGVGEVLSQLALTGKTEHDISIFSINRPALKESLQKT
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |         |    | || |||     | |     ^***  |                   |     | || || |              | | |   |      | |     |  |    |  || || |        |    |         || |||     |  ||      | |  | ^***  |     || || ||| || |                | |||| || |  |      |    |    | |    |  |    ||| || | | |                      ||        | |||     |  |  |    ||||  |  |        |   | || |||| || ||  | |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |         |    | || |||     | |      |    |                   |     | || || |              | | |   |      | |     |  |    |  || || |        |    |         || |||     |  ||      ^**  | |||   |     || || ||| || |                | |||| || |  |      |    |    | |    |  |    ||| || | | |                      ||        | |||     |  |  |    ||||  |  |        |   ^**| |||| || ||  | |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***         |    | || |||     | |      |    |                   |     | || || |              | | |   |      | |     |  |    |  |^*** |        |    |         || |||     ^***|           | |||   |     || || ||| || |                | |||| || |  |      |    |    | |    |  |    ||| || | | |                      ||        ^***|     |  |  |    ||||  |  |        |   | |^***|| || ||  | |     
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..              |    | || |||     | |      |    |                   ******^ || || |              | | |   |      | |     |  |    |  |  |  |        |    |         || |||        ||           | |||   |     || || ||| || |                | |||| || |  |      |    |    | |    |  |    ||| || | | |                      ||          | |     |  |  |    ||||  |  |        |   | || |||| || ||  | |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              ^***** || |||     | |      ^*****                           || || |              | | |   |      | |     |  |    |  |  |  |        ^*****         || |||        ||           | |^*****     |^*****|| || |                | |||| || |  |      ^*****    | ^*****  |    ||| || | | |                      ||          | |     |  |  |    ||||  |  |        |   | || |||| || ||  | |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     || |||     | |                                       || || |              | | |   |      | |     |  |    |  |  |  |                       || |||        ||           | |||         || *****| || |                *****| || |  |                | |    |  |    ||| || | | |                      ||          | |     |  |  |    ||||  |  |        |   | || |||| || ||  | |     
search RasMol script viewer Motif-ligand binding stats  asxturn ..                     || |||     ***                                       || || |              | | |   |      | |     |  |    |  |  |  |                       || |||        ||           | |||         || || ||| || |                | || | || |  |                | |    |  |    *** || | | |                      ||          | |     |  |  |    ||||  |  |        |   | || |*** || ||  | |     
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     || |||                                               || || |              | | |   |      | |     |  |    |  |  |  |                       || |||        **           | |||         || || ||| || |                | || | || |  |                | |    |  |     |  || | | |                      **          | |     |  |  |    ||||  |  |        |   | || | || || ||  | |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     *****|                                               ****| |              | | |   |      | |     ****    ****  |  |                       |****|                     ****|         ************ |                **** | || |  |                | |    |  |     |  || | | |                                  | |     |  |  |    ||||  ****        |   | || | ****| ||  | |     
search RasMol script viewer Motif-ligand binding stats  nest ..                        ***                                                |  | |              *** |   |      ***             |  |  |  |                       |  ***                     | | |                    ***                  |  | |***  |                ***    |  |     |  || | ***                                  ***     |  |  |    ****              |   ***| |  |  | ||  ***     
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                           ******                  |   |                      ****  ****                       |    |                     | | |                                         **** |     |                       ****     *******                                              *******       |              |   | |***  *******          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                   |   |                                                       ******                     | | |                                            | |     |                                                                                                   |              |   | || |     | |           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                   |   |                                                                                  *****                                            | |     |                                                                                                   |              |   | || |     | |           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                   *****                                                                                  | |                                              | |     |                                                                                                   |              ***** || |     | |           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                          ***                                              ***     |                                                                                                   |                  ******     ***           
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                   *                                                                                                   *                                           

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : MONOMERIC SARCOSINE OXIDASE
member of: CATH:search3.30.9.10/search3.50.50.60GENE3D:searchG3DSA_3.30.9.10/searchG3DSA_3.50.50.60HAMAP:searchMF_00516PANTHER:searchPTHR10961/searchPTHR10961_SF8PFAM:searchPF01266SUPERFAMILY:searchSSF51905/searchSSF54373TIGRFAMS:searchTIGR01377UniProt:searchP40859
JMol viewer RasMol script viewer  FAD 400B  ..        ** ***                 ****   *  ***    **                                                                                                                        ***                          *** *   *                *                            *                                                            ***                        * *****                                         
JMol viewer RasMol script viewer  CL 806B  ..        || |||                 ||||   |  |||    ||                                                                                                                        |||                          ||| |   |                |                            |                                                            ||**                       ***||||                                         
JMol viewer RasMol script viewer  PO4 805B  ..        || |||                 ||||   |  |||    ||  *                                                           ***                         ****                          |||                          ||| |   |                |                            |                                                            ||||                       |||||||                                         
JMol viewer RasMol script viewer  PO4 804B  ..        || |||                 ||||   |  |||    ||  |                           *                               |||                         ||||      *  *                |||                          ||| |   |                |                            |                                                            ||||                       |||||||                                         
JMol viewer RasMol script viewer  PO4 802B  ..*       || |||                 ||||   |  |||    ||  |                           |                               |||                         ||||      |  |                |||                          ||| |   |                |                            |                                                            ||||                       |||||||                                         
sec str:  ...eeeeeeee..hhhhhhhhhhhhhh...eeee................eee......hhhhhhhhhhhhhhhhhhhhhh....ee...eeeeee...hhhhhhhhhhhhhh....eeeehhhhhhhh........eeeeee...eeehhhhhhhhhhhhhhhh..eee.......eeee..eeeeee..eeeeeeeeee.hhhhhhhhhhhh.ee...eeeeeeeeee..hhhhhhhhhh..eeeeee..eeeeee.......eeeee....ee.............hhhhhhhhhhhhhhhhhhh..eeeeeeeeeee......eeeee..eeeeeeee.....hhhhhhhhhhhhhhhhhhh.....hhhhh..hhhhh.ee.....
sequence :  ..STHFDVIVVGAGSMGMAAGYQLAKQGVKTLLVDAFDPPHTNGSHHGDTRIIRHAYGEGREYVPLALRSQELWYELEKETHHKIFTKTGVLVFGPKGESAFVAETMEAAKEHSLTVDLLEGDEINKRWPGITVPENYNAIFEPNSGVLFSENCIRAYRELAEARGAKVLTHTRVEDFDISPDSVKIETANGSYTADKLIVSMGAWNSKLLSKLNLDIPLQPYRQVVGFFESDESKYSNDIDFPGFMVEVPNGIYYGFPSFGGCGLKLGYHTFGQKIDPDTINREFGVYPEDESNLRAFLEEYMPGANGELKRGAVCMYTKTLDEHFIIDLHPEHSNVVIAAGFSGHGFKFSSGVGEVLSQLALTGKTEHDISIFSINRPALKESLQKTTI
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |         |    | || |||     | |     ^***  |       |  |        |     | || || |              | |            | |     |  |    |  || || |    |  ||    |          | |||     |  |       | |    ^***  |     || || ||| || |                |  ||| || |  |      |    |    | |    |  |    ||| || | | |                      ||        | |||     |  |  |    ||||  |  |        |   | || |||| || ||  | |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |         |    | || |||     | |      |    |       |  |        |     | || || |              | |            | |     |  |    |  || || |    |  ||    |          | |||     |  |       ^**     |    |     || || ||| || |                |  ||| || |  |      |    |    | |    |  |    ||| || | | |                      ||        | |||     |  |  |    ||||  |  |        |   ^**| |||| || ||  | |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***         |    | || |||     | |      |    |       |  |        |     | || || |              | |            | |     |  |    |  |^*** |    |  ||    |          | |||     ^***               |    |     || || ||| || |                |  ||| || |  |      |    |    | |    |  |    ||| || | | |                      ||        ^***|     |  |  |    ||||  |  |        |   | |^***|| || ||  | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..              |    | || |||     | |      |    |       |  |        ******^ || || |              | |            | |     |  |    |  |  |  |    |  ||    |          | |||                        |    |     || || ||| || |                |  ||| || |  |      |    |    | |    |  |    ||| || | | |                      ||          | |     |  |  |    ||||  |  |        |   | || | || || ||  | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              ^***** || |||     | |      ^*****       |  |                || || |              | |            | |     |  |    |  |  |  |    |  |^*****          | |||                        ^*****     |^*****|| || |                |  ||| || |  |      ^*****    | ^*****  |    ||| || | | |                      ||          | |     |  |  |    ||||  |  |        |   | || | || || ||  | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     || |||     | |                   |  |                || || |              | |            | |     |  |    |  |  |  |    |  |                | |||                                   || *****| || |                *****| || |  |                | |    |  |    ||| || | | |                      ||          | |     |  |  |    ||||  |  |        |   | || | || || ||  | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..                     || |||     ***                   |  |                || || |              | |            | |     |  |    |  |  |  |    |  |                | |||                                   || || ||| || |                |  | | || |  |                | |    |  |    *** || | | |                      ||          | |     |  |  |    ||||  |  |        |   | || | || || ||  | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     || |||                           |  |                || || |              | |            | |     |  |    |  |  |  |    |  |                | |||                                   || || ||| || |                |  | | || |  |                | |    |  |     |  || | | |                      **          | |     |  |  |    ||||  |  |        |   | || | || || ||  | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     *****|                           ****                ****| |              | |            | |     ****    ****  |  |    |  |                ****|                                   ************ |                **** | || |  |                | |    |  |     |  || | | |                                  | |     |  |  |    ||||  ****        |   | || | ****| ||  | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                        ***                                                |  | |              ***            ***             |  |  |  |    |  |                  ***                                              ***                   | | |***  |                ***    |  |     |  || | ***                                  ***     |  |  |    ****              |   ***| |  |  | ||  ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                           ******                                             ****  ****    ****                                                                                         *** |     |                       ****     *******                                              *******       |              |   | |***  *******            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                                                                                                           | |     |                                                                                                   |              ***** || |     | |             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                           ***     |                                                                                                   |                  ******     ***             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                   *                                                                                                   *                                             

   New search    2gb0:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors