triangle PDBeMotif: 2fo0  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.1.112
Classification transferase    | release date: Thu, Jan 12, 2006
Title organization of the sh3-sh2 unit in active and inactive form c-abl tyrosine kinase
Authors B.NAGAR, G.SUPERTI, J.KURIYAN, J.M.DAVIES, M.SEELIGER, O.HANTSCHEL, W.I.WEIS
Method X-RAY DIFFRACTION (resolution: 2.27Å)
PDBe Citation   
Small molecules:    search P16 P16 binding statistics P16   search GOL GOL binding statistics GOL   search MYR MYR binding statistics MYR
Modified residues:  search SEP SEP binding statistics SEP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGQQPGKVLGDQRREPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQ
TKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGK
LYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKK
YSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYM
ATQISSAMEYLEKKNFIHRNLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVW
AFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSIS
DEVEKELGKENLYGQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1 (1B I
member of: CATH:search1.10.510.10/search2.30.30.40/search3.30.200.20/search3.30.505.10GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_2.30.30.40/searchG3DSA_3.30.200.20/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF87PFAM:searchPF00017/searchPF00018/searchPF07714PRINTS:searchSH2DOMAIN/searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109, PROSITE PROFILES:searchPS50001/searchPS50002/searchPS50011, SMART:searchSM00219/searchSM00252/searchSM00326SUPERFAMILY:searchSSF50044/searchSSF55550/searchSSF56112UniProt:searchP00519
JMol viewer RasMol script viewer  GOL 4A  ..                                                                                                                                    ***                                                                                                                                                                                                                                                                                                                                           
JMol viewer RasMol script viewer  GOL 3A  ..                                                                                                                                    |||                                                                                                                                           *     *                                             ****                                                                                                                                        
JMol viewer RasMol script viewer  P16 2A  ..                                                                                                                                    |||                                                                   *    *  *            ***              *   *                      * **** |*    |                                           * ||||    **                                                                                                                                  
JMol viewer RasMol script viewer  MYR 1A  ..                                                                                                                                    |||                                                                   |    |  |            |||              |   |                      | |||| ||    |             **                            | ||||    ||                                                                                *                                       *         
sec str:  ....hhhhhhh..hhhhh....eee..................eeeeeee.....eeeeee..eeeeee...eee..hhhhh..eeee.hhhhhhhhh......eeeeee.......eeeeeee..eeeeeeeee.....ee........hhhhhhhhhhhh.........ee.....................hhh.eeeeee.hhhh...eeeeee.hhheeeeeee......hhhhhhhhhhhhhhh.......eeeee......eeeee.....hhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.hhh.eee.....ee......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhh.....hhhhhhhhhhh
sequence :  ..ARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRNLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELG
seq num:  ..65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|      |  | || || |||         |  |   |  |         ||||    | |      |  | |  ||  |  |    |   |  |  |||^***              | ||  |       || |||   |  |   |  || | |||||||    |             | | || | | || ||| |  | || |||     || |||    || || | |         || || |  |      |  |             | | ||  |          |   |   |  |    | | |||||||||           |  |           |  |  || ||  |   | | | ||         |   | |   | |||  |      | |    |  ||  ||    |  | ||| | |  || |   |     |  ||      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|      |  | || || |||         |  |   |  |         ||||    | |      |  | |  ||  |  |    |   |  |  |||  ||              | ||  |       || |||   |  |   |  || | |||||||    |             | | || | | || ||| |  | || |||     |**^*|    || || | |         || || |  |      |  |             | | ||  |          |   |   |  |    | | |||||||||           |  |           |  |  || ||  |   | | | ||         |   | |   | |||  |      | |    |  ||  ||    |  | ||| | |  || |   |     |  ||      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|      |  | || || |||         |  |   |  |         ||||    | |      |  | |  ||  |  |    |   |  |  |||  ||              ^**|  |       || |||   |  |   |  || | |||||||    |             | | || | | || ||^**  | || |||     || |||    |^**| | |         || || |  |      |  |             | | ||  |          |   |   |  |    | | |||||||||           |  |           |  |  || ||  |   | | ^**|         |   | |   | |||  |      | |    |  ||  ||    |  | ||^** |  || |   |     |  ||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|      |  | |^*** |||         |  |   ^***         ||||    | |      |  | |  ||  |  |    |   |  |  |||  ||                 |  |       ^***||   |  |   ^***| | ||^***|    |             | | || | | || ||     | || |||     || |||    |^*** | |         || || |  |      |  |             | | ||  |          |   |   ^***    | | |||||||||           |  |           |  |  || |^***   | | |  |         |   | |   | |||  |      | |    |  ||  ||    |  | ||  | ^***| |   |     ^***|      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..*      |  | |  || |||         |  |   |  |         ||||    | |      |  | |  ||  |  |    |   |  |  |^*****                 |  |        | |||   |  |   |   | | || || ^*****             ^***** | | || ||     | ^*****     || |||    |  |  | |         || || |  |      |  |             | | ||  |          |   |           | | |||||||||           |  |           |  |  || ||      | | |  |         |   | |   | ^*****      | |    |  ||  ||    |  | ||  | |   | |   |     |   |      
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..       |  | |  || |||         |  |   |  |         ||||    | |      |  | |  ||  |  |    |   |  |  | |  |                  |  |        | |||   |  |   |   | | || || |                    | |  | | || ||     ************************  |  | |         || || |  |      |  |             | | ||  |          |   |           | | |||||||||           |  |           |  |  || ||      | | |  |         |   | |   |  ||  |      | |    |  ||  ||    |  | ||  | |   | |   |     |   |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       |  | |  || |||         |  |   |  |         ||||    | |      |  | |  ||  |  |    |   |  |  | |  |                  |  |        | |||   |  |   |   | | || || |                    | |  | | || ||        | ||      || |||       |  | |         ***** |  |      |  |             | | ||  |          |   |           | | |||||||||           |  |           |  |  || ||      | | |  |         |   | |   |  ||  |      | |    |  |*****    |  | ||  | |   | |   |     |   |      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       |  | |  |*****         |  |   |  |         ||||    | |      |  | |  ||  |  |    |   |  |  | |  |                  |  |        | |||   |  |   |   | | || || |                    | |  | | || ||        | ||      || |||       |  | |         || || |  |      |  |             *****|  |          |   |           | | |||||||||           |  |           |  |  || ||      | | |  |         |   | |   |  ||  |      | |    |  ||  |     |  | ||  | |   | |   |     |   |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..       |  | |  |***|          |  |   |  |         ***|    | |      |  | |  ||  |  |    |   |  |  | |  |                  |  |        | |||   |  |   |   | | || || |                    | |  | | || ||        | ||      || |||       |  | |         || || |  |      |  |             ***  |  |          |   |           | | |||||||||           |  |           |  |  || ||      | | |  |         |   | |   |  ||  |      | |    |  ||  |     |  | ||  | |   | |   |     |   |      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..       |  | |  ||  |          |  |   |  |         ||||    | |      |  | |  ||  |  |    |   |  |  | |  |                  |  |        *****   |  |   |   | | || || |                    | |  | | || ||        | ||      ******       |  | |         || || |  |      |  |                  |  |          |   |           | | |||||||||           |  |           |  |  || ||      | | |  |         |   | |   |  ||  |      | |    |  ||  |     |  | ||  | |   | |   |     |   |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..       |  | |  |****          ****   ****         ||||    | |      |  | |  ||  |  |    |   |  |  | ****                  ****        ****|   |  |   |   | **** || |                    | |  | | ****|        ****       ****|       |  | |         ****| |  |      |  |                  |  |          |   |           | | ||||****|           |  |           ****  *****      | | ****         |   | |   |  |****      | |    |  |****     |  | |**** |   | |   |     |   |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       |  | |  ||  |          |  |   |  |         ||||    | |      |  | |  ||  |  |    |   |  |  | |  |                                | |   |  |   |   |   |  || |                    | |  | |  |  |        | |          | |       |  ***          |  | |  |      |  |                  |  |          |   |           | | |||| || |           |  |           |  |  ||  |      | |              |   | |   |  |          | |    |  |         |  | ||  | |   | |   |     |   |      
search RasMol script viewer Motif-ligand binding stats  nest ..       |  | |  ||  |          |  |   |  |         ****    | |      |  | |  ||  |  |    |   |  |  | |  |                                ***   |  |   |   |   |  |***                    | |  | |  |  |        ***          ***       |  |            |  | |  |      |  |                  |  |          |   |           *** **** || |           |  |           |  |  ||  |      ***              |   ***   |  |          ***    |  |         |  | ||  | |   | |   |     |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..       **** ********          ****   ****                 | |      **** ***********    |   |  **** ****                                      ****   |   |   ****                       ***  ***  ****                               ****            **** ****      ****                  ****          |   |                 |  ****           ****           ****  |****                       |   |     ****                 ****         ********** |   | |   |     |   |      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                          | |                          *****                                                        *****                              | |                                                                                                             |   |                 |   |                                  |   |                       |   |                                                  ***** |   |     *****      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                          | |                                                                                                                          | |                                                                                                             *****                 |   |                                  *****                       *****                                                        *****                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                          ***                                                                                                                          ***                                                                                                                                   |   |                                                                                                                                                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                                                                                             *   *                                                                                                                                                

   New search    2fo0:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML