triangle PDBeMotif: 2f4j  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.1.112
Classification transferase    | release date: Wed, Nov 23, 2005
Title structure of the kinase domain of an imatinib-resistant abl mutant in complex with the aurora kinase inhibitor vx-680
Authors J.KURIYAN, L.H.CHAO, M.A.YOUNG, N.P.SHAH, P.SAWYERS, P.ZARRINKAR
Method X-RAY DIFFRACTION (resolution: 1.91Å)
PDBe Citation   
Small molecules:    search VX6 VX6 binding statistics VX6
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GMSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCT
REPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSR
LMTGDTYTAPAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPE
KVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
member of: CATH:search1.10.510.10/search3.30.200.20GB:search62362414GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF88PFAM:searchPF07714PFAMB:searchPB005637PRINTS:searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109, PROSITE PROFILES:searchPS50011, SMART:searchSM00219SUPERFAMILY:searchSSF55550/searchSSF56112UniProt:searchP00519
JMol viewer RasMol script viewer  VX6 514A  ..                     **   *  *            * *              *                          * ***** *                                                *          *                                                                                                                                    
sec str:  .............hhh.eeeeee.hhhh...eeeeee.hhheeeeeee......hhhhhhhhhhhhh.........eeeee......eeeee.....hhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhee....hhh.eee.hhh.eee......ee.....ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GMSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAPAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQ
seq num:  ..227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| |  || || || ||| |  |||||| |     |**^*|    || || | |         || || |  |   ||     | |          |   ||  || |  |   ||   |   |  |  | ||| | | ||||| |         ||| |          |  |  ||  |  |   | | | ||         ||| |||   | ||| |||  || |||    |  |         |  | ||||| |  |  |   |     |  |         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| |  || || || ||^**  |||||| |     || |||    |^**| | |         || || |  |   ||     | |          |   ||  || |  |   ||   |   |  |  | ||| | | ||||| |         ||| |          |  |  ||  |  |   | | ^**|         ||| |||   | ||| |||  || |||    |  |         |  | ||^** |  |  |   |     |  |         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| |  || || || ||     |||||| |     || |||    |^*** | |         || || |  |   ||     | |          |   ||  || |  |   ||   |   ^***  | ||| | | ||||| |         ||| |          |  |  ||  ^***   | | |  |         ||| |||   | ||| |||  || |||    |  |         |  | || || ^***  |   |     ^***         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****| || || ||     ||^*****     || |||    |     | |         || || |  |   ||     | |          |   ||  || |  |   ||   |         | ||| | | ||||| |         ||| |          |  |  ||  |      | | |  |         ||| |||   | ^*****|  || |||    |  |         |  | || ||       |   |                  
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..  |  || || || ||     ************************     | |         || || |  |   ||     | |          |   ||  || |  |   ||   |         | ||| | | ||||| |         ||| |          |  |  ||  |      | | |  |         ||| |||   |  || |||  || |||    |  |         |  | || ||       |   |                  
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_TYR ..  |  || || || ||      | |||       || |||          | |         || || |  |   ||     | |          |   ||  || |  |   ||   |         | ||****^********         ||| |          |  |  ||  |      | | |  |         ||| |||   |  || |||  || |||    |  |         |  | || ||       |   |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  || || || ||      | |||       || |||          | |         || || |  |   ||     | |          |   ||  || |  |   ||   |         | ||| | | |||||           ||| |          |  |  ||  |      | | |  |         ||| |||   |  |*****  || |||    |  |         |  | || ||       |   |                  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  || || || ||      | |||       || |||          | |         || || |  |   ||     | |          *****|  || |  *****|   |         | ||| | | |||||           ||| |          |  |  ||  |      | | |  |         ||| |||   |  |*****  || |||    |  |         |  | || ||       |   |                  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |***| || ||      | |||       || |||          | |         || || |  |   ||     | |               |  |***       |   |         | ||| | | |||||           ||| |          |  |  ||  |      | | |  |         ||| |||   |  |***|   || |||    |  |         |  | || ||       |   |                  
search RasMol script viewer Motif-ligand binding stats  betabulge ..  |  ||  | || ||      | |||       || |||          | |         || || |  |   **     | |               |  |          |   |         | ||| | | |||||           ||| |          |  |  ||  |      | | |  |         ||| |||   |  ||  |   || |||    |  |         |  | || ||       |   |                  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  |  ||  | || ||      | |||       ******          | |         || || |  |          | |               |  |          |   |         | ||| | | |||||           ||| |          |  |  ||  |      | | |  |         ||| |||   |  ||  |   || |||    |  |         |  | || ||       |   |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  ||  | *****      ****|        ****|          | |         ****| |  |          | |               |  |          |   |         ****| | | ****|           |****          |  |  ||  |      | | ****         ||****|   |  |****   |****|    |  |         |  | ****|       |   |                  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  ||  |  |  |        | |          | |          | |          |  | |  |          ***               |  |          |   |           | | | |  || |           ||| |          |  |  ||  |      | |              ||  | |   |  |       |  | |    |  |         |  | ||  |       |   |                  
search RasMol script viewer Motif-ligand binding stats  nest ..  |  ||  |  |  |        ***          ***          | |          |  | |  |                            |  |          |   |           *** ***  || |           *** |          |  |  ||  |      ***              ||  ***   |  |       |  ***    |  |         |  | ||  |       |   |                  
search RasMol script viewer Motif-ligand binding stats  niche ..  ********  ****                                  | |          **** ****                            ****          |   |                 |  ****            ****          ****  |****                       ||  | |   ****       |    |    ****         **********       |   |                  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                  | |                                                             |   |                 |   |                                  |   |                       |******              ******                                  |   |                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                  | |                                                             *****                 |   |                                  *****                       *****                                                        *****                  
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                  ***                                                                                   |   |                                                                                                                                                  
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                        *   *                                                                                                                                                  

   New search    2f4j:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors