triangle PDBeMotif: 2dos  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Classification hydrolase    | release date: Wed, May 3, 2006
Title structural basis for the recognition of lys48-linked polyubi chain by the josephin domain of ataxin-3, a putative deubiq enzyme
Authors A.SUMIYOSHI
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GPLGSMESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFF
SIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQL
QQEGYSIFVVKGDLPD
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1  model: 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ATAXIN-3
sec str:  ...............hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhh............hhhhhhhhhhh...eeee..hhhhhhhh.......eeeeee..eeeeeeee..eeeee.......eeehhhhhhhhhhhhhhhh.eeeeee.....
sequence :  ..MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPD
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|  |      |   || |||| |||   | |||||||||||| ||| |  |  | |||||||||     | |      | |||||||||   |  | |  || | |  |            ^**         |  ||  |   |  |  |  |                 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|  |      |   || |||| |||   ^***|||||||||| ||| |  |  ^***|||||||     | |      | |||||||||   |  | |  || | |  |                        |  |^***   |  |  |  |                 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..****      ^***** |||| |||     |||||||||||| ||| |  ^***** |||||||     | |      | |||||||||   |  | |  || | |  |                        |  |       |  |  |  |                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |          *****|| |||     |*************** |  |      |*****|     | |      ********|||   |  | |  || | |  |                        |  |       |  |  |  |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |          **** |****|     ********* *****  ****      *******     | |      **********|   **** ****| | ****                        ****       **********                 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |               |  | |                                            ***              | |   |  |     | | |  |                        |  |                                  
search RasMol script viewer Motif-ligand binding stats  nest ..|  |               |  ***                                                             ***   |  |     *** |  |                        |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..****               |    |                                                                   ****         ****                        ****                                  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                   ******                                                                                                                                                  

Assembly 1  model: 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ATAXIN-3
sec str:  ...............hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhh............hhhhhhhhhhh...eeee..hhhhhhhh.......eeeeee..eeeeeeee..eeeee.......eeehhhhhhhhhhhhhhhh.eeeeee.....
sequence :  ..MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPD
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..   |      |    |   || |||   |  |   |  || |  |  |  |  | || ||||||   | |            |||||||   |  | |  || | |  |      | ||  ^**         |  ||| |  || ||  |  ||  ||            
search RasMol script viewer Motif-ligand binding stats  PS00006 ..   |      |    |   || |||   ^***   |  || |  |  |  |  ^*** ||||||   | |            |||||||   |  | |  || | |  |      | ||              |  |^***  || ||  |  ||  ||            
search RasMol script viewer Motif-ligand binding stats  PS00008 ..****      ^*****   || |||          |  || |  |  |  ^*****| ||||||   | |            |||||||   |  | |  || | |  |      | ||              |  | |    || ||  |  ||  ||            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   || |||          ***** |  |  |  |     ********   | |            ******|   |  | |  || | |  |      | ||              |  | |    *****  |  |*****            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   |****|          ****  **********     ********   | |            ******|   **** ****| | ****      ****              **** |    ***************             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   |  | |                                          ***                | |   |  |     | | |  |      ***               |  | |                                
search RasMol script viewer Motif-ligand binding stats  nest ..                   |  ***                                                             ***   |  |     *** |  |                        |  | |                                
search RasMol script viewer Motif-ligand binding stats  niche ..                   |    |                                                                   ****         ****                        ******                                
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                   ******                                                                                                                                                  

Assembly 1  model: 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ATAXIN-3
sec str:  ...............hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhh............hhhhhhhhhhh...eeee..hhhhhhhh.......eeeeee..eeeeeeee..eeeee.......eeehhhhhhhhhhhhhhhh.eeeeee.....
sequence :  ..MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPD
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|  |      |    |  | ||||| | | ||||||  |||| ||| |  |  | ||  ||  || |    | |     | |||||| |   |  | |  || | |  |            ^** |  |    |  ||  |      |  |  |                 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..|  |      |    |  | ||||| | ^***||||  |||| ||| |  |  ^***  ||  || |    | |     | |||||| |   |  | |  || | |  |                |  |    |  |^***      |  |  |                 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..****      ^*****  | ||||| |   ||||||  |||| ||| |  ^*****|  ||  || |    | |     | |||||| |   |  | |  || | |  |                |  |    |  |          |  |  |                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |              | ||||| |   |*************** |  |     |  ||  || |    | |     *****||| |   |  | |  || | |  |                |  |    |  |          |  |  |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |              ******| |   ********* *****  ****     ********| |    | |     *******| |   |  | ****| | ****                ****    ****          *******                 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |                  | ***                                     ***    | |            | |   |  |     | | |  |                        |  |                                  
search RasMol script viewer Motif-ligand binding stats  nest ..|  |                  ***                                              ***            ***   |  |     *** |  |                        |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..****                                                                                        ****         ****                        ****                                  

Assembly 1  model: 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ATAXIN-3
sec str:  ...............hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhh............hhhhhhhhhhh...eeee..hhhhhhhh.......eeeeee..eeeeeeee..eeeee.......eeehhhhhhhhhhhhhhhh.eeeeee.....
sequence :  ..MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPD
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..   |      |    |  ||||||| | |  |  |  || ||   | ||||  | |||| || |     | |||     | ||||||||   |  | | ||||| |  |            ^**         |  ||  |   |  |  |  ||  ||            
search RasMol script viewer Motif-ligand binding stats  PS00006 ..   |      |    |  ||||||| | ^***  |  || ||   | ||||  ^***|| || |     | |||     | ||||||||   |  | | ||||| |  |                        |  |^***   |  |  |  ||  ||            
search RasMol script viewer Motif-ligand binding stats  PS00008 ..****      ^*****  ||||||| |       |  || ||   | |||^***** || || |     | |||     | ||||||||   |  | | ||||| |  |                        |  |       |  |  |  ||  ||            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..               ********|| |       ********   *****|      ***** |     | |||     ********||   |  | | ||||| |  |                        |  |       |  |  |  |*****            
search RasMol script viewer Motif-ligand binding stats  betaturn ..               *********| |       ********   ******      *******     ****|     *********|   **** ******| ****                        ****       **************             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   |  | ***                                          | | |            | |   |  |     | | |  |                        |  |                                  
search RasMol script viewer Motif-ligand binding stats  nest ..                   |  ***                                            *****            ***   |  |     *** |  |                        |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..                   |    |                                                                   ****         ****                        ****                                  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                   ******                                                                                                                                                  

Assembly 1  model: 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ATAXIN-3
sec str:  ...............hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhh............hhhhhhhhhhh...eeee..hhhhhhhh.......eeeeee..eeeeeeee..eeeee.......eeehhhhhhhhhhhhhhhh.eeeeee.....
sequence :  ..MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPD
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..||||      |    |  |||||||   |  || || ||||| ||  |  |  | |||||||||        | |     |  || |||   |  | | ||||| |  |            ^** | |     |  ||  |   |  |  |  ||  ||            
search RasMol script viewer Motif-ligand binding stats  PS00006 ..||||      |    |  |||||||   ^***| || ||||| ||  |  |  ^***|||||||        | |     |  || |||   |  | | ||||| |  |                | |     |  |^***   |  |  |  ||  ||            
search RasMol script viewer Motif-ligand binding stats  PS00008 ..****      ^*****  |||||||      || || ||||| ||  |  ^*****||||||||        | |     |  || |||   |  | | ||||| |  |                | |     |  |       |  |  |  ||  ||            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..||||              *****||      **************  |  |     |*****||        | |     |  || |||   |  | *****|| |  |                | |     |  |       |  |  |  |*****            
search RasMol script viewer Motif-ligand binding stats  betaturn ..||||              ******|      ********************     ********        | |     ********|   **** ******| ****                | |     ****       **************             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***|               |  | |                                               | |           | |   |  |     | |                     ***     |  |                                  
search RasMol script viewer Motif-ligand binding stats  nest .. | |               |  ***                                               | |           ***   |  |     ***                             |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche .. ***               |    |                                               ***                 ****                                     ****                                  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                   ******                                                                                                                                                  

Assembly 1  model: 6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ATAXIN-3
sec str:  ...............hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhh............hhhhhhhhhhh...eeee..hhhhhhhh.......eeeeee..eeeeeeee..eeeee.......eeehhhhhhhhhhhhhhhh.eeeeee.....
sequence :  ..MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPD
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..   |      |    |  |||||||| ||  |  ||  || |  || |  |  | || || ||        ||||      || ||| |        | ||||| |  |      ||||  ^** |  |    | |||| |   |  |  |  |                 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..   |      |    |  |||||||| |^***  ||  || |  || |  |  ^*** || ||        ||||      || ||| |        | ||||| |  |      ||||      |  |    | ||^***   |  |  |  |                 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..****      ^*****  |||||||| |   |  ||  || |  || |  ^*****  || ||        ||||      || ||| |        | ||||| |  |      ||||      |  |    | ||||     |  |  |  |                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                  *****||| |   ********* ***** |  |    ***** ||        ||||      || ||| |        | ||||| |  |      ||||      |  |    | ||||     |  |  |  |                 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                  |||||||| |   |  ||  |  |  |  |  |    |  || ||        ||||      || ||| |        | ||||| |  |      ||||      |  |    *****|     |  |  |  |                 
search RasMol script viewer Motif-ligand binding stats  asxturn ..                  |||||||| |   |  ||  |  |  |  |  |    |  || ||        ||||      || ||| |        | ||||| |  |      ||||      |  |    ***| |     |  |  |  |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                  ******|| |   ********************    ********        ||||      *****| |        ******| ****      ||||      ****    **** |     ****  ****                 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   |  | || |                                           ||||           | |            | | |  |      ***|              |  | |                                
search RasMol script viewer Motif-ligand binding stats  nest ..                   |  ******                                           ****           ***            *** |  |       | |              |  | |                                
search RasMol script viewer Motif-ligand binding stats  niche ..                   |    |                                                                                ****       ***              ******                                
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                   ******                                                                                                                                                  

Assembly 1  model: 7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ATAXIN-3
sec str:  ...............hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhh............hhhhhhhhhhh...eeee..hhhhhhhh.......eeeeee..eeeeeeee..eeeee.......eeehhhhhhhhhhhhhhhh.eeeeee.....
sequence :  ..MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPD
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..||||      |    |   || ||| | | |||||| ||||| ||| || | ||||| | ||||     | || |    | |||| |||   |  | |  || | |  |      ||||  ^**         |  ||  |   |  |  |  ||  ||            
search RasMol script viewer Motif-ligand binding stats  PS00006 ..||||      |    |   || ||| | ^***|||| ||||| ||| || | |^*** | ||||     | || |    | |||| |||   |  | |  || | |  |      ||||              |  |^***   |  |  |  ||  ||            
search RasMol script viewer Motif-ligand binding stats  PS00008 ..****      ^*****   || ||| |   |||||| ||||| ||| || ^*****  | ||||     | || |    | |||| |||   |  | |  || | |  |      ||||              |  |       |  |  |  ||  ||            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..||||               || ||| |   |**************| || | | |   *****|     | || |    | ||*****|   |  | ***** | |  |      ||||              |  |       |  |  |  |*****            
search RasMol script viewer Motif-ligand binding stats  betaturn ..||||               |****| |   ************** ****** | |   ******     | || |    *********|   **** ****| | ****      ****              |  |       ****  ********             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***|               |  | ***                         | |              | || |           | |   |  |     | | |  |      ***|              |  |                                  
search RasMol script viewer Motif-ligand binding stats  nest .. | |               |  ***                           ***              ******           ***   |  |     *** |  |       | |              |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche .. ***               |    |                                                                   ****         ****       ***              ****                                  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                   ******                                                                                                                                                  

Assembly 1  model: 8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ATAXIN-3
sec str:  ...............hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhh............hhhhhhhhhhh...eeee..hhhhhhhh.......eeeeee..eeeeeeee..eeeee.......eeehhhhhhhhhhhhhhhh.eeeeee.....
sequence :  ..MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPD
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..   |      |    |  |||||||   | || |||  |  |  || || |  | ||| |||||   ||||         || || |||   |  | | ||||| |  |      ||||  ^** |  |    |  ||  |   |  |  |  ||  ||            
search RasMol script viewer Motif-ligand binding stats  PS00006 ..   |      |    |  |||||||   ^*** |||  |  |  || || |  ^***| |||||   ||||         || || |||   |  | | ||||| |  |      ||||      |  |    |  |^***   |  |  |  ||  ||            
search RasMol script viewer Motif-ligand binding stats  PS00008 ..****      ^*****  |||||||     || |||  |  |  || || ^*****|| |||||   ||||         || || |||   |  | | ||||| |  |      ||||      |  |    |  |       |  |  |  ||  ||            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                  *****||     || |||  |  |  || || |     |*****||   ||||         || *****|   |  | *****|| |  |      ||||      |  |    |  |       |  |  |  |*****            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                  ******|     *********************     ********   ||||         ********|   **** ******| ****      ||||      ****    ****       **************             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   |  | |                                          ****               | |   |  |     | | |  |      ***|              |  |                                  
search RasMol script viewer Motif-ligand binding stats  nest ..                   |  ***                                                             ***   |  |     *** |  |       | |              |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..                   |    |                                                                   ****         ****       ***              ****                                  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                   ******                                                                                                                                                  

Assembly 1  model: 9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ATAXIN-3
sec str:  ...............hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhh............hhhhhhhhhhh...eeee..hhhhhhhh.......eeeeee..eeeeeeee..eeeee.......eeehhhhhhhhhhhhhhhh.eeeeee.....
sequence :  ..MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPD
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..   |      |    |  ||| ||| | |  ||||||||||||||| |  |  | |||| ||||   | | | |      || ||||||   |  | |  || | |  |            ^**         |  ||  |   |  |  |  |                 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..   |      |    |  ||| ||| | ^***|||||||||||||| |  |  ^***|| ||||   | | | |      || ||||||   |  | |  || | |  |                        |  |^***   |  |  |  |                 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..****      ^*****  ||| ||| |     |||||||||||||| |  ^***** || ||||   | | | |      || ||||||   |  | |  || | |  |                        |  |       |  |  |  |                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..               *****| ||| |     ||************ |  |      ******|   | | | |      ******|||   |  | ***** | |  |                        |  |       |  |  |  |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..               *********| |     *************  ****      *******   | | | |      ********|   |  | ****| | ****                        ****       **********                 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                      | ***                                        | | | |            | |   |  |     | |                             |  |                                  
search RasMol script viewer Motif-ligand binding stats  nest ..                      ***                                          | | ***            ***   |  |     ***                             |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                   ***                      ****                                     ****                                  

Assembly 1  model: 10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ATAXIN-3
sec str:  ...............hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhh............hhhhhhhhhhh...eeee..hhhhhhhh.......eeeeee..eeeeeeee..eeeee.......eeehhhhhhhhhhhhhhhh.eeeeee.....
sequence :  ..MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPD
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..   |      |    | ||||||||   | || ||| ||| |  || || |  | |||| || |  |  | ||||     || || |||        | ||||| |  |            ^** |  |    |  ||  |  || ||  |  |                 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..   |      |    | ||||||||   ^*** ||| ||| |  || || |  ^***|| || |  |  | ||||     || || |||        | ||||| |  |                |  |    |  |^***  || ||  |  |                 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..****      ^***** ||||||||     |  ||| ||| |  || || ^***** || || |  |  | ||||     || || |||        | ||||| |  |                |  |    |  |      || ||  |  |                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 ||||||||     ********** |  || || |      ***** |  |  | ||||     || *****|        | ||||| |  |                |  |    |  |      *****  |  |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 *******|     *********************      *******  |  | ||||     ********|        ******| ****                ****    ****      ***********                 
search RasMol script viewer Motif-ligand binding stats  nest ..                   |  ***                                         |  | ****           ***            *** |  |                        |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..                   |    |                                         ****                                   ****                        ****                                  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                   ******                                                                                                                                                  

   New search    2dos:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML