triangle PDBeMotif: 2btp  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein/peptide    | release date: Sun, Jun 5, 2005
Title 14-3-3 protein theta (human) complexed to peptide
Authors A.C.E.JOHANSSON, A.EDWARDS, C.ARROWSMITH, C.SMEE, D.A.DOYLE, J.M.ELKINS, M.SUNDSTROM, STRUCTURAL GENOMICS CONSORTIUM, X.YANG
Method X-RAY DIFFRACTION (resolution: 2.80Å)
PDBe Citation   
Modified residues:  search SEP SEP binding statistics SEP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MHHHHHHSSGVDLGTENLYFQSMEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSA
WRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDR
KQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIM
QLLRDNLTLWTSDSAG
Chains P,Q sequence:
RQRSAP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : 14-3-3 PROTEIN TAU
member of: GENE3D:searchG3DSA_1.20.190.20PANTHER:searchPTHR18860PFAM:searchPF00244PIRSF:searchPIRSF000868PRINTS:search1433ZETAPROSITE PATTERNS:searchPS00796/searchPS00797, SMART:searchSM00101SUPERFAMILY:searchSSF48445UniProt:searchP27348
sec str:  ..................hhhhhh.hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..MHHHHHHSSGVDLGTENLYFQSMEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKT..KKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTS
seq num:  ..-21       -11       -1        9         19        29        39        49        59         ..74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |    |||| ||  | | ||           || |||           | |||  || ||         | |  | ||   | ||  |..|             |   |   |  |        ^*** |      |       | |  |   || ||              ||||||  |    |   ^***     | |     |   |  |       |  | ||||        | ^*** ||
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |    |||| ||  | | ||           || |||           | |||  || ||         | |  | ||   | ||  |..|             |   |   |  |         ||| |      |       | |  |   |**^*              ||||||  |    |    |       | |     |   |  |       |  | ||||        |  ||| ||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |    |||| ||  | | ||           || |||           | |||  || ||         | |  | ||   | ||  |..*             |   |   |  |         ||| |      |       | |  |   |   |              ^**|||  |    |    |       | |     |   |  |       |  | ^**|        |  ||| ||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |    ^*** ||  | | ||           || |||           | |||  ^***|         | |  | ||   ^***  |..              |   |   ^***         |^***      |       | |  |   |   |              ^***||  |    |    |       | |     |   ^***       ^*** ^***        |  ||| ||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|  |    |||| ||  | | ||           || |||           | |||  ||  |         | |  | ||   | |   |..              |   |                | | |      ********^ |  |   |   |               |  ||  |    |    |       | |     |   |                |          |  ||| ||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |    |^*****  | | ||           || |||           | |^*****  |         | ^*****|   | |   |..              |   |                | | |                |  |   |   |               |  ||  |    ^*****       | |     |   |                |          |  ||| ||
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|  |    | || |   | | ||           || |||           | |||  |   |         | ^***  |   | |   |..              |   |                | | |                |  |   |   |               |  ||  |                 | |     |   |                |          |  ||| ||
search RasMol script viewer Motif-ligand binding stats  1433_1 ..|  |    | || |   | | ||           || |||           | |||  |   ***********       |   | |   |..              |   |                | | |                |  |   |   |               |  ||  |                 | |     |   |                |          |  ||| ||
search RasMol script viewer Motif-ligand binding stats  1433_2 ..|  |    | || |   | | ||           || |||           | |||  |   |                 |   | |   |..              |   |                | | |                |  |   |   |               |  ||  |                 | |     |   |                ********************
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |    | |***   | | ||           || |||           | |||  |   |                 |   | |   |..              |   |                | ***                |  |   |   |               |  ||  |                 | |     |   |                           |  ||| ||
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |    | |      | | ||           |****|           ****|  |   |                 |   | |   |..              |   |                | |                  |  |   |   |               |  |****                 | |     |   |                           |  ||****
search RasMol script viewer Motif-ligand binding stats  nest ..|  |    ***      | | ||           |  ***             ***  |   |                 |   | |   |..              |   |                ***                  |  |   |   |               |  ||  |                 ***     |   |                           |  ||  | 
search RasMol script viewer Motif-ligand binding stats  niche ..****             | ****           |    |                  |   |                 |   | |   |..              |   |                                     ****   |   |               ********                         |   |                           |  ||  | 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                 |   |            ******                  |   |                 |   | |   |..              |   |                                            |   |                                                |   |                           |  ||  | 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                 |   |                                    *****                 |   | |   |..              |   |                                            |   |                                                |   |                           |  ||  | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                                          ***** *****..              *****                                            *****                                                *****                           ******** 

chain B : 14-3-3 PROTEIN TAU
member of: GENE3D:searchG3DSA_1.20.190.20PANTHER:searchPTHR18860PFAM:searchPF00244PIRSF:searchPIRSF000868PRINTS:search1433ZETAPROSITE PATTERNS:searchPS00796/searchPS00797, SMART:searchSM00101SUPERFAMILY:searchSSF48445UniProt:searchP27348
sec str:  ..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh... ..hhhhhhhhhhhhhhhhhhh..
sequence :  ..EKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKT..KKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDT... ..SYKDSTLIMQLLRDNLTLWTS
seq num:  ..2         12        22        32        42        52        62      ..74        84        94        104       114       124       134       144       154       164       174       184       194         ... ..210       220        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           || |||             |||  || ||         | |  | ||   |  |   ..|             |  ||  ||  |        ^*** | |    |       | |  |    | ||              ||||||  |    |   ^***     | |     |   |  |       |..PS00001..||||          ^*** ||
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..           || |||             |||  || ||         | |  | ||   |  |   ..|             |  ||  ||  |         ||| | |    |       | |  |    **^*              ||||||  |    |    |       | |     |   |  |       |..PS00004..||||           | | ||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           || |||             |||  || ||         | |  | ||   |  |   ..*             |  ||  ||  |         ||| | |    |       | |  |                      ^**|||  |    |    |       | |     |   |  |       |..PS00005..^**|           | | ||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           || |||             |||  ^***|         | |  | ||   ^***   ..              |  ||  |^***         |^*** |    |       | |  |                      ^***||  |    |    |       | |     |   ^***       ^..PS00006..^***           | | ||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           || |||             |||  ||  |         | |  | ||   |      ..              |  ||  |             | | | |    ********^ |  |                       |  ||  |    |    |       | |     |   |           ..PS00007..|| |           | | ||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           || |||             |^*****  |         | ^*****|   |      ..              |  ||  |             | | | |              |  |                       |  ||  |    ^*****       | |     |   |           ..PS00008..|| |           | | ||
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..           || |||             | |  |   |         | ^***  |   |      ..              |  ||  |             | | | |              |  |                       |  ||  |                 | |     |   |           ..PS00009..|| |           | | ||
search RasMol script viewer Motif-ligand binding stats  1433_1 ..           || |||             | |  |   ***********       |   |      ..              |  ||  |             | | | |              |  |                       |  ||  |                 | |     |   |           ..PS00796..|| |           | | ||
search RasMol script viewer Motif-ligand binding stats  1433_2 ..           || |||             | |  |   |                 |   |      ..              |  ||  |             | | | |              |  |                       |  ||  |                 | |     |   |           ..PS00797..|********************
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           || |||             | |  |   |                 |   |      ..              |  ||  |             | *****              |  |                       |  ||  |                 | |     |   |           ..asxmotif..|  |           | | ||
search RasMol script viewer Motif-ligand binding stats  asxturn ..           || |||             | |  |   |                 |   |      ..              |  ||  |             | ***                |  |                       |  ||  |                 | |     |   |           ..asxturn..|  |           | | ||
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |****|             | |  |   |                 |   |      ..              |  ||  |             | |                  |  |                       |  |****                 | |     |   |           ..betaturn..****           | ****
search RasMol script viewer Motif-ligand binding stats  nest ..           |  ***             ***  |   |                 |   |      ..              |  ||  |             ***                  |  |                       |  ||  |                 ***     |   |           ..nest..               |   | 
search RasMol script viewer Motif-ligand binding stats  niche ..           |    |                  |   |                 |   |      ..              |  ||  |                                  ****                       ********                         |   |           ..niche..               |   | 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..           ******                  |   |                 |   |      ..              |  ||  |                                                                                              |   |           ..schellmannloop..               |   | 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                   *****                 |   |      ..              |  ||  |                                                                                              |   |           ..stmotif..               |   | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                         *****      ..              ********                                                                                              *****           ..ststaple..               ***** 

chain P : CONSENSUS PEPTIDE FOR 14-3-3 PROTEINS
sec str:  ........
sequence :  ..RQRSAP
seq num:  ..2     

chain Q : CONSENSUS PEPTIDE FOR 14-3-3 PROTEINS
sec str:  ........
sequence :  ..RQRSAP
seq num:  ..2     

   New search    2btp:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors