triangle PDBeMotif: 2adm  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.1.1.72
Classification methyltransferase    | release date: Mon, Jul 15, 1996
Title adenine-n6-dna-methyltransferase taqi
Authors G.SCHLUCKEBIER, W.SAENGER
Method X-RAY DIFFRACTION (resolution: 2.60Å)
PDBe Citation   
Small molecules:    search SAM SAM binding statistics SAM
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MGLPPLLSLPSNSAPRSLGRVETPPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHGTGYRFVGVEIDPKALDLP
PWAEGILADFLLWEPGEAFDLILGNPPYGIVGEASKYPIHVFKAVKDLYKKAFSTWKGKYNLYGAFLEKAVRLLKPGGVL
VFVVPATWLVLEDFALLREFLAREGKTSVYYLGEVFPQKKVSAVVIRFQKSGKGLSLWDTQESESGFTPILWAEYPHWEG
EIIRFETEETRKLEISGMPLGDLFHIRFAARSPEFKKHPAVRKEPGPGLVPVLTGRNLKPGWVDYEKNHSGLWMPKERAK
ELRDFYATPHLVVAHTKGTRVVAAWDERAYPWREEFHLLPKEGVRLDPSTLVQWLNSEAMQKHVRTLYRDFVPHLTLRML
ERLPVRREYGFHTSPESARNF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
member of: CATH:search3.40.50.150/search3.90.220.10GENE3D:searchG3DSA_3.40.50.150/searchG3DSA_3.90.220.10PFAM:searchPF12950/searchPF13659PIRSF:searchPIRSF037236PRINTS:searchN12N6MTFRASEPROSITE PATTERNS:searchPS00092, SUPERFAMILY:searchSSF116734/searchSSF53335UniProt:searchP14385
JMol viewer RasMol script viewer  SAM 500A  ..  *                     * **   *                  **               ***              ***     ..                         *                                                                                                                                                                                                                                                                           
sec str:  ......hhhhhhhhhh.......eeeee.....hhhhhhhhhh....eeeeee............eeee.............eeeee..........hhhhhhhhhhh.........hhhhhhhhhhhh.....eeeeeeehhhh..hhhhhhhhhhhhh.eeeeeeee.........eeeeeee.....eeeeeeeee..eeeeeeeeee............hhhhhhhh.eeehhhheeeee...hhhhh............eee...hhh...............eeehhhhhh..hhhh..eeee.........eeee.........eeeee...eee.hhhhhhhh..hhhhhhhhhhh........hhhhhh.eee...eee.
sequence :  ..VETPPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHGTGYRFVGVEIDPKALDLPPWAEGILADFLLWEPGEAFDLILGNPPYGIVG..VFKAVKDLYKKAFSTWKGKYNLYGAFLEKAVRLLKPGGVLVFVVPATWLVLEDFALLREFLAREGKTSVYYLGEVFPQKKVSAVVIRFQKSGKGLSLWDTQESESGFTPILWAEYPHWEGEIIRFETEETRKLEISGMPLGDLFHIRFAARSPEFKKHPAVRKEPGPGLVPVLTGRNLKPGWVDYEKNHSGLWMPKERAKELRDFYATPHLVVAHTKGTRVVAAWDERAYPWREEFHLLPKEGVRLDPSTLVQWLNSEAMQKHVRTLYRDFVPHLTLRMLERLPVRREYGFHT
seq num:  ..21        31        41        51        61        71        81        91        101         ..121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  |     || || |  |     ||| |           | |     | || ||  |  |     || ||        |     |    ..        || || |||   | |       |  ||  |         |  |                      | | || ||      | | |  |  |   |  |     || |  || |        | | | || | || |          |  |  |    |  |    ||| ||  |     ^***|      || || |  |                   | |          |  |         |  |   ||   | |  |    | | |  |  |  |   |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  |  |     || || |  |     ||| |           | |     | || ||  |  |     || ||        |     |    ..        || || |||   | |       |  ||  |         |  |                      | | |**^*      | | |  |  |   |  |     || |  || |        | | | || | || |          |  |  |    |  |    ||| ||  |       | |      || || |  |                   | |          |  |         |  |   ||   | |  |    | | |  |  |  |   |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |     || || |  |     ||| |           | |     | || ||  |  |     || ||        |     |    ..        || || ^**   | |       |  ||  |         |  |                      | | |  |       | ^**  |  |   |  |     || |  || |        ^** | || | || |          |  |  |    |  |    ^** ||  |       | |      || || |  |                   | |          |  |         |  |   ||   | |  |    ^** |  |  |  |   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ^***     |^*** |  |     ||| |           | |     | || ||  |  |     || ||        |     |    ..        || ||  |    | |       |  ||  |         |  |                      | | |  |       | |    ^***   |  |     || |  || |          | | || | || |          |  |  |    |  |     |  ||  |       | |      || || |  |                   | |          |  |         |  |   ||   | |  |        |  |  |  |   ^
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  |  |  |     ||| |           | |     | || ||  |  |     || ||        |     |    ..        || ||  |    | |       |  ||  |         |  |                      | | |  |       | |           |  |     || |  || |          | | |^***** |          |  |  |    |  |     |  ||  |       | |      || || |  |                   | |          |  |         |  |   ||   | |  |        |  |  |  |    
search RasMol script viewer Motif-ligand binding stats  N6_MTASE ..           |  |  |  |     ||| |           | |     | || ||  |  |     || ||        *******    ..        || ||  |    | |       |  ||  |         |  |                      | | |  |       | |           |  |     || |  || |          | | || | || |          |  |  |    |  |     |  ||  |       | |      || || |  |                   | |          |  |         |  |   ||   | |  |        |  |  |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |  |  |  |     ||| |           | |     | *****  |  |     *****                   ..        *****  |    | |       |  ||  |         |  |                      | | |  |       | |           |  |     || |  || |          | | || | || |          |  |  |    |  |     |  ||  |       | |      ***** |  |                   | |          |  |         |  |   ||   | |  |        |  |  |  |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..           |  |  |  |     ||| |           | |     | || ||  |  |     || ||                   ..        || ||  |    ***       |  ||  |         |  |                      | | |  |       | |           |  |     || |  || |          | | || | || |          |  |  |    |  |     |  ||  |       | |      || || |  |                   | |          |  |         |  |   ||   | |  |        |  |  |  |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..           |  |  |  |     ||| |           | |     | || ||  |  |     || ||                   ..        || ||  |              |  ||  |         |  |                      | | |  |       | |           |  |     ** |  || |          | | || | || |          |  |  |    |  |     |  ||  |       | |      || || |  |                   | |          |  |         |  |   ||   | |  |        |  |  |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |  |  ****     |****           | |     | ****|  |  |     ****|                   ..        ****|  |              |  |****         |  |                      | | |  |       | |           ****        |  || |          | | || **** |          |  |  |    |  |     |  ||  |       | |      ****| ****                   | |          |  |         |  |   ||   | ****        |  |  ****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           |  |  |  |     | |             ***     | ||  |  |  |      |  |                   ..         |  |  |              |  ||  |         |  |                      | | |  |       ***                       |  || |          | | ||   |  |          |  |  |    |  |     |  ||  |       | |       |  | |  |                   | |          |  |         |  |   ||   |             |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..           |  |  |  |     ***                     | ||  |  |  |      |  |                   ..         |  |  |              |  ||  |         |  |                      | | |  |                                 |  |***          | | ||   |  |          |  |  |    |  |     |  ||  |       ***       |  | |  |                   ***          |  |         |  |   ||   |             |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..           ****  ****                             *******  ****      ****                   ..         *******              ********         ****                      ********                                 ****             | ****   ****          *******    ****     ********                 **** ****                                ****         ****   ||   |             ****          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                            ..                                                                                                                                   |   |                                                                                                                        *****|   |                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                            ..                                                                                                                                   *****                                                                                                                             *****                           

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : ADENINE-N6-DNA-METHYLTRANSFERASE TAQI
member of: CATH:search3.40.50.150/search3.90.220.10GENE3D:searchG3DSA_3.40.50.150/searchG3DSA_3.90.220.10PFAM:searchPF12950/searchPF13659PIRSF:searchPIRSF037236PRINTS:searchN12N6MTFRASEPROSITE PATTERNS:searchPS00092, SUPERFAMILY:searchSSF116734/searchSSF53335UniProt:searchP14385
JMol viewer RasMol script viewer  SAM 500B  ..* *                     * *    *                  **                *               ***     ..                         *                                                                                                                                                                                                                                                                           
sec str:  ......hhhhhhhhhh.......eeeee.....hhhhhhhhhh....eeeeee...........eeeee.............eeeee..........hhhhhhhhhhh.........hhhhhhhhhhhh.....eeeeeeehhhh..hhhhhhhhhhhhh.eeeeeeee.........eeeeeee.....eeeeeeeee..eeeeeeeeee............hhhhhhhh.eeehhhheeeee...hhhhh............eee.....................eeehhhhhh..hhhh..eeee.........eeee.........eeeee...eee.hhhhhhhh..hhhhhhhhhhh........hhhhhh.eee...eee.
sequence :  ..VETPPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHGTGYRFVGVEIDPKALDLPPWAEGILADFLLWEPGEAFDLILGNPPYGIVG..VFKAVKDLYKKAFSTWKGKYNLYGAFLEKAVRLLKPGGVLVFVVPATWLVLEDFALLREFLAREGKTSVYYLGEVFPQKKVSAVVIRFQKSGKGLSLWDTQESESGFTPILWAEYPHWEGEIIRFETEETRKLEISGMPLGDLFHIRFAARSPEFKKHPAVRKEPGPGLVPVLTGRNLKPGWVDYEKNHSGLWMPKERAKELRDFYATPHLVVAHTKGTRVVAAWDERAYPWREEFHLLPKEGVRLDPSTLVQWLNSEAMQKHVRTLYRDFVPHLTLRMLERLPVRREYGFHT
seq num:  ..21        31        41        51        61        71        81        91        101         ..121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  || |||   || || |  |     ||| |           | |     | || ||  |  |     || ||        |     |    ..        || || |||   | |       |  ||  |         |  |                      | | || ||      | | |  |  |   |  |     || |  || |        | | | || | || |          |  |  |    |  |    ||||||  |     ^***|  |  ||| || |  |                   | |          |  |         |  |   ||   | |  |    | | |  |  |  |   |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  || |||   || || |  |     ||| |           | |     | || ||  |  |     || ||        |     |    ..        || || |||   | |       |  ||  |         |  |                      | | |**^*      | | |  |  |   |  |     || |  || |        | | | || | || |          |  |  |    |  |    ||||||  |       | |  |  ||| || |  |                   | |          |  |         |  |   ||   | |  |    | | |  |  |  |   |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  || |||   || || |  |     ||| |           | |     | || ||  |  |     || ||        |     |    ..        || || ^**   | |       |  ||  |         |  |                      | | |  |       | ^**  |  |   |  |     || |  || |        ^** | || | || |          |  |  |    |  |    ^**|||  |       | |  |  ||| || |  |                   | |          |  |         |  |   ||   | |  |    ^** |  |  |  |   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ^***||   |^*** |  |     ||| |           | |     | || ||  |  |     || ||        |     |    ..        || ||  |    | |       |  ||  |         |  |                      | | |  |       | |    ^***   |  |     || |  || |          | | || | || |          |  |  |    |  |    ||||||  |       | |  |  ||| || |  |                   | |          |  |         |  |   ||   | |  |        |  |  |  |   ^
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  ||   |  |  |  |     ||| |           | |     | || ||  |  |     || ||        |     |    ..        || ||  |    | |       |  ||  |         |  |                      | | |  |       | |           |  |     || |  || |          | | |^***** |          |  |  |    |  |    ||||||  |       | |  |  ||| || |  |                   | |          |  |         |  |   ||   | |  |        |  |  |  |    
search RasMol script viewer Motif-ligand binding stats  N6_MTASE ..   |  ||   |  |  |  |     ||| |           | |     | || ||  |  |     || ||        *******    ..        || ||  |    | |       |  ||  |         |  |                      | | |  |       | |           |  |     || |  || |          | | || | || |          |  |  |    |  |    ||||||  |       | |  |  ||| || |  |                   | |          |  |         |  |   ||   | |  |        |  |  |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   *****   |  |  |  |     ||| |           | |     | *****  |  |     *****                   ..        *****  |    | |       |  ||  |         |  |                      | | |  |       | |           |  |     || |  || |          | | || | || |          |  |  |    |  |    ||||||  |       | |  |  |***** |  |                   | |          |  |         |  |   ||   | |  |        |  |  |  |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  |    |  |  |  |     ||| |           | |     | || ||  |  |     || ||                   ..        || ||  |    ***       |  ||  |         |  |                      | | |  |       | |           |  |     || |  || |          | | || | || |          |  |  |    |  |    ||||||  |       | |  |  ||| || |  |                   | |          |  |         |  |   ||   | |  |        |  |  |  |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..   |  |    |  |  |  |     ||| |           | |     | || ||  |  |     || ||                   ..        || ||  |              |  ||  |         |  |                      | | |  |       | |           |  |     ** |  || |          | | || | || |          |  |  |    |  |    ||||||  |       | |  |  ||| || |  |                   | |          |  |         |  |   ||   | |  |        |  |  |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****    |  |  ****     |****           | |     | ****|  |  |     ****|                   ..        ****|  |              |  |****         |  |                      | | |  |       | |           ****        |  || |          | | || **** |          ****  |    |  |    ****||  |       | |  ********| ****                   | |          ****         |  |   ||   | ****        |  |  ****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           |  |  |  |     | |             ***     | ||  |  |  |      |  |                   ..         |  |  |              |  ||  |         |  |                      | | |  |       ***                       |  || |          | | ||   |  |          |  |  |    |  |    ||| ||  |       | |       |  | |  |                   | |          |  |         |  |   ||   |             |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..           |  |  |  |     ***                     | ||  |  |  |      |  |                   ..         |  |  |              |  ||  |         |  |                      | | |  |                                 |  |***          | | ||   |  |          |  |  |    |  |    ||| ||  |       ***       |  | |  |                   ***          |  |         |  |   ||   |             |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..           ****  ****                             *******  ****      ****                   ..         *******              ********         ****                      ********                                 ****             | ****   ****          *******    ****    |********                 **** ****                                ****         ****   ||   |             ****          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                            ..                                                                                                                                   |   |                                     *****                                                                              *****|   |                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                            ..                                                                                                                                   *****                                     | |                                                                                     *****                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                            ..                                                                                                                                                                             ***                                                                                                                     

   New search    2adm:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors