triangle PDBeMotif: 2abl  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.1.112
Classification transferase    | release date: Sun, Nov 17, 1996
Title sh3-sh2 domain fragment of human bcr-abl tyrosine kinase
Authors C.A.FREDERICK, H.-J.NAM
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRN
AAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHY
PAP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ABL TYROSINE KINASE
member of: CATH:search2.30.30.40/search3.30.505.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF87PFAM:searchPF00017/searchPF00018PRINTS:searchSH2DOMAINPROSITE PROFILES:searchPS50001/searchPS50002, SMART:searchSM00252/searchSM00326SUPERFAMILY:searchSSF50044/searchSSF55550UniProt:searchP00519
sec str:  ...........eeee..................eeeeeee.....eeeeee..eeeeeehhheee...hhh.........hhhhhhh........eeeee.......eeeeeee..eeeeeee..................hhhhhhhhhh..............
sequence :  ..MGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAP
seq num:  ..75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  |  |                 |  |         ||||    | |      |  |    ||| |  |               ||^***       | ||   | |           || |||          | ||    | |||||    |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  |  |                 |  |         ||||    | |      |  |    ||| |  |               ||  ||       | ||   ^**           || |||          | ||    | |||||    |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ^***  |                 ^***         ||||    | |      |  |    ||| |  |               ||  ||       | ||                 ^***||          ^***    | ^***|    |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  |  |                 |  |         ||||    | |      |  |    ||| |  |               ^*****       | ||                  | |||          | |     |  || ^*****     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..   |  |  |                 |  |         ||||    | |      |  |    ||| |  |                |  |        | ||                  *****          | |     |  || |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  |  |                 |  |         ||||    | |      |  |    ||| |  |                |  |        | ||                  ****|          | |     |  || |          
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |  |                 |  |         ****    | |      |  |    ||| |  |                |  |        | ||                    ***          | |     |  |***          
search RasMol script viewer Motif-ligand binding stats  niche ..   *******                 ****                 | |      ****    |*******                ****        ****                                 | |     ****             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                ***              ***                                 ***                                  ***                      

   New search    2abl:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML