triangle PDBeMotif: 1zlm  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein    | release date: Fri, May 6, 2005
Title crystal structure of the sh3 domain of human osteoclast stimulating factor
Authors D.TOH, D.WELLS, E.DIGIAMMARINO, E.J.MEEHAN, H.HAROLD, J.ZHOU, L.CHEN, Y.WANG
Method X-RAY DIFFRACTION (resolution: 1.07Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OSTEOCLAST STIMULATING FACTOR 1
member of: CATH:search2.30.30.40GENE3D:searchG3DSA_1.25.40.20/searchG3DSA_2.30.30.40PANTHER:searchPTHR24155/searchPTHR24155_SF10PFAM:searchPF00018PRINTS:searchP67PHOX/searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchQ92882
sec str:  .....eeeee..................eeeeee.....eeeeee..eeeeee...eee.
sequence :  ..GQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQ
seq num:  ..12        22        32        42        52        62      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..              || || | |  |    |||||  |  |^** | |   || |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              |^*** | |  |    |||||  |  |    | |   || |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..              ******^ |  |    |||||  |  |    | |   || |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..               | ||   |  |    |||||  |  ^***** ^***** |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..               | ||   |  |    |***|  |             |  |   
search RasMol script viewer Motif-ligand binding stats  betabulge ..               | ||   |  |    **| |  |             |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..               | ||   ****      | |  |             |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..               ****   ****      ******             ****   
search RasMol script viewer Motif-ligand binding stats  stturn ..               ***                                        

   New search    1zlm:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors