triangle PDBeMotif: 1yom  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.1.112
Classification transferase    | release date: Thu, Jan 27, 2005
Title crystal structure of src kinase domain in complex with purvalanol a
Authors C.B.BREITENLECHNER, E.GREITER, H.KOLL, K.HONOLD, N.A.KAIRIES, R.A.ENGH, R.HUBER, S.KOCH, S.SCHEIBLICH, W.SCHAEFER
Method X-RAY DIFFRACTION (resolution: 2.90Å)
PDBe Citation   
Small molecules:    search P01 P01 binding statistics P01
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
QTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS
EEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARL
IEDNEWTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPES
LHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF53PFAM:searchPF07714PFAMB:searchPB003089/searchPB005637PRINTS:searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109, PROSITE PROFILES:searchPS50011, SMART:searchSM00219SUPERFAMILY:searchSSF55550/searchSSF56112UniProt:searchP12931
JMol viewer RasMol script viewer  P01 1A  ..                  **      *           *                             *              ***** *                                                *           ..                                                                                                              
sec str:  ...............eeeeeee......eeeee.....eeeeee..............hhhhhhh.......eeeee.....eeee......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.hhh.eee..........hhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh........hhhhhhhhhhhhhhhh..........
sequence :  ..LAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVAD..FPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
seq num:  ..257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       ..426       436       446       456       466       476       486       496       506       516       526       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  |  | |||    |          |  ^***|   || |    | |        |  | |  |   ||                 |  |     |||||                     | | | |  |  | |          ..  |  |  |   | | | |||  | |  ||| ||||   |  |          | |    |  |  |  |   |  | || || |   |        |  |  |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  |  | ^**    |          |    ^**   |^**    | |        |  | |  |   ||                 |  |     ^**||                     | | | |  |  | |          ..  |  |  |   | | ^**||  | |  ||| ^**|   |  |          | |    |  |  |  |   |  | || || |   |        |  |  |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  |  |  |     |          |    |     |       | |        |  | |  |   ||                 ^***     || ||                     | | | |  |  | |          ..  |  ^***   | | |  ||  | |  ||| || |   |  |          | |    |  |  ^***   |  | || || |   |        ^***  |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  |  |  |     |          ^*****     |       | |        |  | |  |   ||                          || ||                     | | | |  |  | |          ..  |  |      | | |  ||  | ^***** || |   |  |          | |    |  |         |  | || || |   |           |  |      
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..   |  |  |  |     ***********************       | |        |  | |  |   ||                          || ||                     | | | |  |  | |          ..  |  |      | | |  ||  |    ||  || |   |  |          | |    |  |         |  | || || |   |           |  |      
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_TYR ..   |  |  |  |                                   | |        |  | |  |   ||                          || ||                     | ****^********          ..  |  |      | | |  ||  |    ||  || |   |  |          | |    |  |         |  | || || |   |           |  |      
search RasMol script viewer Motif-ligand binding stats  betabulge ..   |  |  |  |                                   | |        |  | |  |   **                          || ||                     | | | |  |  |            ..  |  |      | | |  ||  |    ||  || |   |  |          | |    |  |         |  | || || |   |           |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  |  |  |                                   | |        |  | |  |                               ****|                     | | | |  ****            ..  |  |      | | |  ||  |    ||  || |   ****          | |    ****         |  | ****| |   |           |  |      
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |  |  |                                   | |        |  | |  |                                |  |                     *** ***  |  |            ..  |  |      *** |  ||  |    ||  |***   |  |          ***    |  |         |  | ||  | |   |           |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..   ****  ****                                   | |        **** ****                                ****                           |  ****            ..  ****          |  ||  |    ||  ||     ****                 ****         ********** |   |           ****      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                | |                                                                                |                  ..                *****  |    ||  ||                                                  *****                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                | |                                                                                |                  ..                   *****    ******                                                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                ***                                                                                |                  ..                                                                                                              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                   *                  ..                                                                                                              

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF53PFAM:searchPF07714PFAMB:searchPB003089/searchPB005637PRINTS:searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109, PROSITE PROFILES:searchPS50011, SMART:searchSM00219SUPERFAMILY:searchSSF55550/searchSSF56112UniProt:searchP12931
JMol viewer RasMol script viewer  P01 2B  ..                  **      *           *                             *              ***** *                                                *            ..P01 ..                                                                                                              
sec str:  ..................ee......eeeee........eeeeee......hhhhhhhhhhhhhh.......eeeee.....eeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee...... ...hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhh.........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhh..........
sequence :  ..LAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADF... ..FPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
seq num:  ..257       267       277       287       297       307       317       327       337       347       357       367       377       387       397        ... ..426       436       446       456       466       476       486       496       506       516       526       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  |    | |    |          |  ^***|   || | | |                |  |                      |  |     ||| |      |  ||       || ||| | |  |  | |           ..PS00001.. ||  |  |   | | | |||  | || ||| ||||   |  |          | |    |  |  |  |   |  | ||  | |   |     |  || |         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  |    ^**    |          |    ^**   |^** | |                |  |                      |  |     ^** |      |  ||       || ||| | |  |  | |           ..PS00005.. ||  |  |   | | ^**||  | || ||| ^**|   |  |          | |    |  |  |  |   |  | ||  | |   |     |  || |         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  |           |          |    |     |    | |                |  |                      ^***      |  |      |  ||       || ||| | |  |  | |           ..PS00006.. ||  ^***   | | |  ||  | || ||| || |   |  |          | |    |  |  ^***   |  | ||  | |   |     |  ^***         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  |           |          ^*****     |    | |                |  |                                |  |      |  ||       || ||| | |  |  | |           ..PS00008.. ||  |      | | |  ||  | ^***** || |   |  |          | |    |  |         |  | ||  | |   |     |   |           
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..   |  |           ***********************    | |                |  |                                |  |      |  ||       || ||| | |  |  | |           ..PS00107.. ||  |      | | |  ||  |  | ||  || |   |  |          | |    |  |         |  | ||  | |   |     |   |           
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_TYR ..   |  |                                      | |                |  |                                |  |      |  ||       || ||****^********           ..PS00109.. ||  |      | | |  ||  |  | ||  || |   |  |          | |    |  |         |  | ||  | |   |     |   |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |                                      | |                |  |                                |  |      *****       || ||| | |  |  |             ..alphabetamotif.. ||  |      | | |  ||  |  | ||  || |   |  |          | |    |  |         |  | ||  | |   |     |   |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  |                                      | |                |  |                                |  |      ****        |****| | |  ****             ..betaturn.. ||  |      | | |  ||  |  ****  || |   ****          | |    |  |         |  | ||  | |   |     |   |           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   |  |                                      ***                |  |                                |  |                  |  | | | |  |  |             ..gammaturn.. ||  |      | | |  ||  |    ||  || |   |  |          | |    |  |         |  | ||  | |   |     |   |           
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |                                                         |  |                                |  |                  |  *** ***  |  |             ..nest.. ||  |      *** |  ||  |    ||  |***   |  |          ***    |  |         |  | ||  | |   |     |   |           
search RasMol script viewer Motif-ligand binding stats  niche ..   ****                                                         ****                                ****                  |    |   |  ****             ..niche.. |****          |  ||  |    ||  ||     ****                 ****         ********** |   |     |   |           
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                                          ******   |                   ..schellmannloop.. |   |          |  ||  |    ||  ||                                                  |   |     |   |           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                                                   |                   ..stmotif.. |   |          *****  |    ||  ||                                                  *****     |   |           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                   |                   ..ststaple.. *****             *****    ******                                                            *****           
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                   *                   ..REP00000..                                                                                                              

   New search    1yom:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML