triangle PDBeMotif: 1xx2  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.5.2.6
Classification hydrolase    | release date: Wed, Nov 3, 2004
Title refinement of p99 beta-lactamase from enterobacter cloacae
Authors J.R.KNOX, T.SUN
Method X-RAY DIFFRACTION (resolution: 1.88Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
TPVSEKQLAEVVANTITPLMKAQSVPGMAVAVIYQGKPHYYTFGKADIAANKPVTPQTLFELGSISKTFTGVLGGDAIAR
GEISLDDAVTRYWPQLTGKQWQGIRMLDLATYTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFGA
LAVKPSGMPYEQAMTTRVLKPLKLDHTWINVPKAEEAHYAWGYRDGKAVRVSPGMLDAQAYGVKTNVQDMANWVMANMAP
ENVADASLKQGIALAQSRYWRIGSMYQGLGWEMLNWPVEANTVVEGSDSKVALAPLPVAEVNPPAPPVKASWVHKTGSTG
GFGSYVAFIPEKQIGIVMLANTSYPNPARVEAAYHILEALQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : BETA-LACTAMASE
member of: CATH:search3.40.710.10GENE3D:searchG3DSA_3.40.710.10PANTHER:searchPTHR22935/searchPTHR22935_SF58PFAM:searchPF00144PROSITE PATTERNS:searchPS00336, SUPERFAMILY:searchSSF56601UniProt:searchP05364
sec str:  ....hhhhhhhhhhhhhhhhhhhh...eeeeeeee..eeeeeeeeeee....ee......ee...hhhhhhhhhhhhhhhh.......hhhhhh....hhhhh..hhhhhhh...............hhhhhhhhhhhh........ee..hhhhhhhhhhhhhhhhh.hhhhhhhhhh........ee...hhhhhhhh..eee..eee......hhhhhh..eehhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh.eeeee..eee....eeee...hhhhhhhhhhhhhhh..ee.eeeeeee.....eeeeeeee....eeeeeee....eeeeeee....hhhhhhhhhhhhhhh.
sequence :  ..PVSEKQLAEVVANTITPLMKAQSVPGMAVAVIYQGKPHYYTFGKADIAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLDDAVTRYWPQLTGKQWQGIRMLDLATYTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFGALAVKPSGMPYEQAMTTRVLKPLKLDHTWINVPKAEEAHYAWGYRDGKAVRVSPGMLDAQAYGVKTNVQDMANWVMANMAPENVADASLKQGIALAQSRYWRIGSMYQGLGWEMLNWPVEANTVVEGSDSKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQIGIVMLANTSYPNPARVEAAYHILEAL
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  | |||              | | |    |             ||  | |  |  | || |||||| ||    | | |||||  |       ||||| || || |   |||| |     |  | |^***   |  |      |||| | ^***|    |    | |   |  ||| || ||| |     || ||  |              | | || |||  |||           |  | | | | |  | ||                        |  |  | ||| |              | |   | | |  ||    ||  | |      ^*** |  ||          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  ^**||              | | |    |             ||  | |  |  | || |||||| ||    | | |||||  |       ||^** || || |   |||| |     |  | |   |   |  |      |^** | |   |    |    | |   |  ^** || ||| |     || ||  |              | | || |||  |||           |  | | ^** |  | ||                        |  |  | ||| |              | |   | | |  ||    ||  | |           |  ||          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | |||              | | |    |             ||  | |  |  ^*** |||||| ||    | | ||||^***       ||||| || || |   |||| |     |  | |   |   |  |      | |  | |   |    |    | |   |   |  || ||| |     || ||  |              | | || |||  |||           |  | |     |  | ||                        ^***  | ||| |              | |   | | |  ||    ||  | |           |  ||          
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | |||              | | |    |             ||  | |  |  | |  |||||| ||    | | |||||  |       ||||| || |*******^|| |     |  | |   |   |  |      | |  | |   |    |    | |   |   |  || ||| |     |******^              | | || |||  |||           |  | |     |  | ||                           |  | ||| |              | |   | | |  ||    ||  | |           |  ||          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | |||              | | ^*****             ||  | |  |  | |  |||||| |^***** | |||||  |       ||||| || |  |   |||| |     |  | |   |   |  |      | |  | |   ^*****    | |   |   |  || ||| |     |  ||  |              ^***** |^*****|           |  | |     ^*****|                           |  | ||| |              | |   | ^*****^*****|  | |           |  ||          
search RasMol script viewer Motif-ligand binding stats  BETA_LACTAMASE_C ..  | |||              | |                    ||  | |  |  | ****^***| |       | |||||  |       ||||| || |  |   |||| |     |  | |   |   |  |      | |  | |             | |   |   |  || ||| |     |  ||  |                | |  | |  | |           |  | |        |  |                           |  | ||| |              | |   |   |  |      |  | |           |  ||          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  *****              | |                    ||  | |  |  |    |||||| |       | |||||  |       ||||| || |  |   |||| |     |  | |   |   |  |      | |  | |             | |   |   |  || ||| |     |  ||  |                | |  | |  | |           |  | |        |  |                           |  | ||| |              | |   |   |  |      |  | |           *****          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | |||              | |                    ||  | |  |  |    |||||| |       | |||||  |       ||||| || |  |   |||| |     |  | *****   |  |      | |  | |             | |   |   |  || ||| |     |  ||  |                | |  | |  | |           |  | |        |  |                           |  ***** |              | |   |   |  |      |  | |           |  |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | |||              | |                    ||  | |  |  |    |||||| |       | |||||  |       ||||| || |  |   |||| |     |  |         |  |      | |  | |             | |   |   |  || ||| |     |  ||  |                | |  | |  ***           |  | |        |  |                           |  ***|  |              | |   |   |  |      |  | |           |  |           
search RasMol script viewer Motif-ligand binding stats  betabulge ..  | |||              | |                    **  | |  |  |    |||||| |       | |||||  |       ||||| || |  |   |||| |     |  |         |  |      | |  | |             | |   |   |  || ||| |     |  ||  |                | |  | |                |  | |        |  |                           |  |  |  |              | |   |   |  |      |  | |           |  |           
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  | |||              | |                        | |  |  |    |||||| |       | |||||  |       ||||| || |  |   |||| |     |  |         |  |      | |  | |             | |   |   |  || ||| |     |  ||  |                | |  | |                |  | |        |  |                           |  |  |  |              | |   |   |  |      ******           |  |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****|              | |                        | |  ****    ****** |       ****||****       ||||| || |  |   |||| |     ****         |  |      | |  | |             | |   |   |  |****| |     ********                | |  | |                **** |        |  |                           |  ****  |              | |   |   |  |         | |           ****           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  | | |              | |                        | |  |  |     | ||  |         |||||  |       ***|| || |  |   |||| |     |  |         |  |      | |  | |             | |   |   |  |  | | |         |  |                | |  | |                |  | |        |  |                           |  |  |  |              ***   |   |  |         | |                          
search RasMol script viewer Motif-ligand binding stats  nest ..  | | |              ***                        ***  |  |     | ||  |         ****|  |        | || || |  |   ******     |  |         |  |      ***  | |             ***   |   |  |  *** |         |  |                ***  | |                |  | |        |  |                           |  |  |  |                    |   |  |         ***                          
search RasMol script viewer Motif-ligand binding stats  niche ..  | | |                                              ****     | ||  |             ****        *********  |   |          ****         ****           | |             | |   |   |  |    | |         ****                     ***                ******        ****                           ****  ****                    |   ****                                      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..  | | |                                                       | ||  |                                    |   |                                      | |             | |   |   |  ****** |                                                                                                                                |                                             
search RasMol script viewer Motif-ligand binding stats  stmotif ..  *****                                                       | ||  |                                    |   |                                      | |             | |   |   |         |                                                                                                                                |                                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..  | |                                                         | *****                                    *****                                      | |             | |   *****         |                                                                                                                                |                                             
search RasMol script viewer Motif-ligand binding stats  stturn ..  ***                                                         |  |                                                                                  | |             ***                 |                                                                                                                                |                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                              *  *                                                                                  * *                                 *                                                                                                                                *                                             

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : BETA-LACTAMASE
member of: CATH:search3.40.710.10GENE3D:searchG3DSA_3.40.710.10PANTHER:searchPTHR22935/searchPTHR22935_SF58PFAM:searchPF00144PROSITE PATTERNS:searchPS00336, SUPERFAMILY:searchSSF56601UniProt:searchP05364
sec str:  ....hhhhhhhhhhhhhhhhhhhhh..eeeeeee....eeeeeeeeee....ee......ee...hhhhhhhhhhhhhhhh.......hhhhh.....hhhhh..hhhhhhh...............hhhhhhhhhhhh........ee..hhhhhhhhhhhhhhhhh.hhhhhhhhhh.............hhhhhhhh..eee..eee......hhhhhh..eehhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh.eeeee..eee....eeee...hhhhhhhhhhhhhhh..ee.eeeeeee.....eeeeeeee....eeeeeee....eeeeeee....hhhhhhhhhhhhhhh.
sequence :  ..PVSEKQLAEVVANTITPLMKAQSVPGMAVAVIYQGKPHYYTFGKADIAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLDDAVTRYWPQLTGKQWQGIRMLDLATYTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFGALAVKPSGMPYEQAMTTRVLKPLKLDHTWINVPKAEEAHYAWGYRDGKAVRVSPGMLDAQAYGVKTNVQDMANWVMANMAPENVADASLKQGIALAQSRYWRIGSMYQGLGWEMLNWPVEANTVVEGSDSKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQIGIVMLANTSYPNPARVEAAYHILEAL
seq num:  ..1002      1012      1022      1032      1042      1052      1062      1072      1082      1092      1102      1112      1122      1132      1142      1152      1162      1172      1182      1192      1202      1212      1222      1232      1242      1252      1262      1272      1282      1292      1302      1312      1322      1332      1342      1352     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  | |      |   |     | | |    |             ||  | |  | ||||| || ||   |    | | |||||  |        |||| || || |   |||| |     |  |  ^***   |  |      |||| | ^***|    |    | |   |  ||| || ||| ||    || ||  |    |  |      | | || |||  ||| |         |  | | | | | || ||                        |  |  |  || |              | |   | | |  ||    ||  | |      ^***                
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  ^**      |   |     | | |    |             ||  | |  | ||||| || ||   |    | | |||||  |        |^** || || |   |||| |     |  |         |  |      |^** | |   |    |    | |   |  ^** || ||| ||    || ||  |    |  |      | | || |||  ||| |         |  | | ^** | || ||                        |  |  |  || |              | |   | | |  ||    ||  | |                          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | |      |   |     | | |    |             ||  | |  | |^*** || ||   |    | | ||||^***        | || || || |   |||| |     |  |         |  |      | |  | |   |    |    | |   |   |  || ||| ||    || ||  |    |  |      | | || |||  ||| |         |  | |     | || ||                        ^***  |  || |              | |   | | |  ||    ||  | |                          
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | |      |   |     | | |    |             ||  | |  | ||||  || ||   |    | | |||||  |        | || || |*******^|| |     |  |         |  |      | |  | |   |    |    | |   |   |  || ||| ||    |******^    |  |      | | || |||  ||| |         |  | |     | || ||                           |  |  || |              | |   | | |  ||    ||  | |                          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | |      |   |     | | ^*****             ||  | |  | ||||  || ||   ^***** | |||||  |        | || || |  |   |||| |     |  |         |  |      | |  | |   ^*****    | |   |   |  || ||| ||    |  ||  |    |  |      ^***** |^*****| |         |  | |     ^*****|                           |  |  || |              | |   | ^*****^*****|  | |                          
search RasMol script viewer Motif-ligand binding stats  BETA_LACTAMASE_C ..  | |      |   |     | |                    ||  | |  | |||****^***          | |||||  |        | || || |  |   |||| |     |  |         |  |      | |  | |             | |   |   |  || ||| ||    |  ||  |    |  |        | |  | |  | | |         |  | |       ||  |                           |  |  || |              | |   |   |  |      |  | |                          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |      |   |     | |                    ||  | |  | |||   || ||          | |||||  |        | || || |  |   |||| |     |  |         |  |      | |  | |             | |   |   |  || ||| ||    |  ||  |    |  |        | |  | |  | | |         |  | |       ||  |                           |  ***** |              | |   |   |  |      |  | |                          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | |      |   |     | |                    ||  | |  | |||   || ||          | |||||  |        | || || |  |   |||| |     |  |         |  |      | |  | |             | |   |   |  || ||| ||    |  ||  |    |  |        | |  | |  *****         |  | |       ||  |                           |  |  |  |              | |   |   |  |      |  | |                          
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | |      |   |     | |                    ||  | |  | |||   || ||          | |||||  |        | || || |  |   |||| |     |  |         |  |      | |  | |             | |   |   |  || ||| ||    |  ||  |    |  |        | |  | |  ***           |  | |       ||  |                           |  |  |  |              | |   |   |  |      |  | |                          
search RasMol script viewer Motif-ligand binding stats  betabulge ..  | |      |   |     | |                    **  | |  | |||   || ||          | |||||  |        | || || |  |   |||| |     |  |         |  |      | |  | |             | |   |   |  || ||| ||    |  ||  |    |  |        | |  | |                |  | |       ||  |                           |  |  |  |              | |   |   |  |      |  | |                          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  | |      |   |     | |                        | |  | |||   || ||          | |||||  |        | || || |  |   |||| |     |  |         |  |      | |  | |             | |   |   |  || ||| ||    |  ||  |    |  |        | |  | |                |  | |       ||  |                           |  |  |  |              | |   |   |  |      ******                          
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |      |   |     | |                        | |  ****|   *****          ****|||  |        | || || |  |   |||| |     |  |         |  |      | |  | |             | |   |   |  |****| ||    ********    ****        | |  | |                **** |       ||  |                           |  ****  |              | |   |   |  |         | |                          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  | |      |   |     | |                        | |  | |||    |  |            |||||  |        | || || |  |   |||| |     |  |         |  |      | |  | |             | |   |   |  |  | | ||        |  |                | |  | |                |  | |       ||  |                           |  |  |  |              ***   |   |  |         | |                          
search RasMol script viewer Motif-ligand binding stats  nest ..  | |      |   |     ***                        ***  | |||    |  |            ****|  |        | || || |  |   ******     |  |         |  |      ***  | |             ***   |   |  |  *** ||        |  |                ***  | |                |  | |       ||  |                           |  |  |  |                    |   |  |         ***                          
search RasMol script viewer Motif-ligand binding stats  niche ..  | |      |   |                                     ****|    |  |                ****        *********  |   |          ****         ****           | |             | |   |   |  |    ****        ****                     ***                ******       |****                           ****  ****                    |   ****                                      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..  | |      |   |                                     | | |    |  |                                       |   |                                      | |             | |   |   |  ****** |                                                                  |   |                                                         |                                             
search RasMol script viewer Motif-ligand binding stats  stmotif ..  | |      |   |                                     *****    |  |                                       |   |                                      | |             | |   |   |         |                                                                  |   |                                                         |                                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..  | |      *****                                     | |      |  |                                       *****                                      | |             | |   *****         |                                                                  *****                                                         |                                             
search RasMol script viewer Motif-ligand binding stats  stturn ..  ***                                                ***      |  |                                                                                  | |             ***                 |                                                                                                                                |                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                              *  *                                                                                  * *                                 *                                                                                                                                *                                             

   New search    1xx2:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors