triangle PDBeMotif: 1wyx  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification cell adhesion    | release date: Thu, Feb 17, 2005
Title the crystal structure of the p130cas sh3 domain at 1.1 a resolution
Authors B.BOSSENMAIER, F.HESSE, G.GEORGES, I.IOANNIDIS, K.P.KUENKELE, M.DANGL, M.WISNIEWSKA, R.A.ENGH, R.HUBER
Method X-RAY DIFFRACTION (resolution: 1.14Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search EDO EDO binding statistics EDO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
HLNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CRK-ASSOCIATED SUBSTRATE
member of: CATH:search2.30.30.40GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10654/searchPTHR10654_SF5PFAM:searchPF00018PRINTS:searchSH3DOMAIN/searchSPECTRNALPHAPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchP56945
JMol viewer RasMol script viewer  MG 181B  ..                                                                    
JMol viewer RasMol script viewer  EDO 177A  ..                                                *                   
sec str:  ...eeeeee..................eeeeee.hhhhh..eeeeee..eeeeee...eeeeeeeee...
sequence :  ..LNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKP
seq num:  ..2         12        22        32        42        52        62      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..              |  | ^**  |  | || || ||  |    |  | |   || |  |  |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              ^***   |  |  ^*** || ||  |    |  | |   || |  |  |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              |  |   |  |    || || ||  |    |  | ^***** |  |  |     
search RasMol script viewer Motif-ligand binding stats  betabulge ..              |  |   |  |    ** || ||  |    |  |     |  |  |  |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..              |  |   ****       *****  |    ****     |  |  ****     
search RasMol script viewer Motif-ligand binding stats  niche ..              ****   ****           ****             ****  ****     

chain B : CRK-ASSOCIATED SUBSTRATE
member of: CATH:search2.30.30.40GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10654/searchPTHR10654_SF5PFAM:searchPF00018PRINTS:searchSH3DOMAIN/searchSPECTRNALPHAPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchP56945
JMol viewer RasMol script viewer  MG 181B  ..                                                                     
sec str:  ...eeeeeee..................eeeeee.hhhhh..eeeeee..eeeeee...eeeeeeeeee..
sequence :  ..HLNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKP
seq num:  ..1         11        21        31        41        51        61       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..               |  | ^**  |  | ||     |  |         |   || |  |  |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..               ^***   |  |  ^***     |  |         |   || |  |  |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..               |  |   |  |    ||     |  |         ^***** |  |  |     
search RasMol script viewer Motif-ligand binding stats  betabulge ..               |  |   |  |    **     |  |             |  |  |  |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..               |  |   ****           |  |             |  |  ****     
search RasMol script viewer Motif-ligand binding stats  niche ..               ****   ****           ****             ****  ****     

   New search    1wyx:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML