triangle PDBeMotif: 1w1o  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.5.99.12
Classification oxidoreductase    | release date: Wed, Jun 23, 2004
Title native cytokinin dehydrogenase
Authors A.MATTEVI, E.MALITO
Method X-RAY DIFFRACTION (resolution: 1.70Å)
PDBe Citation   
Small molecules:    search NAG NAG binding statistics NAG   search FAD FAD binding statistics FAD
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MAVVYYLLLAGLIACSHALAAGTPALGDDRGRPWPASLAALALDGKLRTDSNATAAASTDFGNITSALPAAVLYPSSTGD
LVALLSAANSTPGWPYTIAFRGRGHSLMGQAFAPGGVVVNMASLGDAAAPPRINVSADGRYVDAGGEQVWIDVLRASLAR
GVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITGHGEMVTCSKQLNADLFDAVLGGLGQFGVITRARI
AVEPAPARARWVRFVYTDFAAFSADQERLTAPRPGGGGASFGPMSYVEGSVFVNQSLATDLANTGFFTDADVARIVALAG
ERNATTVYSIEATLNYDNATAAAAAVDQELASVLGTLSYVEGFAFQRDVAYAAFLDRVHGEEVALNKLGLWRVPHPWLNM
FVPRSRIADFDRGVFKGILQGTDIVGPLIVYPLNKSMWDDGMSAATPSEDVFYAVSLLFSSVAPNDLARLQEQNRRILRF
CDLAGIQYKTYLARHTDRSDWVRHFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOKININ DEHYDROGENASE 1
member of: CATH:search3.40.462.10GENE3D:searchG3DSA_3.30.43.10/searchG3DSA_3.30.465.10/searchG3DSA_3.40.462.10PANTHER:searchPTHR13878/searchPTHR13878_SF14PFAM:searchPF01565/searchPF09265PROSITE PATTERNS:searchPS00862, PROSITE PROFILES:searchPS51387, SUPERFAMILY:searchSSF55103/searchSSF56176UniProt:searchQ9T0N8
JMol viewer RasMol script viewer  NAG 1540A  ..                                                                                                                                                                                                                                          ..NAG ..              *                            *             ..                                                                                                                      ..NAG ..                                                                      
JMol viewer RasMol script viewer  NAG 1539A  ..                                                                                          *                                                                                                                                               ..NAG ..              |                            |             ..                                                                                                                      ..NAG ..                                                                      
JMol viewer RasMol script viewer  NAG 1538A  ..                                                                                          *** *                                                                                                      *                                    ..NAG ..              |                            |             ..                                                                                                                      ..NAG ..                                                                      
JMol viewer RasMol script viewer  NAG 1537A  ..                                              *  *                                        ||| |                                                                        *                             |                                    ..NAG ..              |                            |             ..                                                                                                                      ..NAG ..                                                                      
JMol viewer RasMol script viewer  NAG 1536A  ..                   *   ***                    |  |                                        ||| |                                                                        |                             |                                    ..NAG ..              |                            |             ..                                                                                                                      ..NAG ..                                                                      
JMol viewer RasMol script viewer  FAD 1535A  ..                   | * |||                    |  |          *******   **         *        ||| |                                 ***  ** **  ** **                      |                      *  *** |                                    ..FAD ..              |                            |             ..                                               *     *                                                                ..FAD ..                          **                                  *  *    
sec str:  .........ee.hhhhhhhh.............eee...hhhhhhhhhhhhhhh......eeee...............eeee.hhhhh......eee.....eeeee...hhhhhhhhhhh..eee.........hhhhhhh......hhhhhhhhhh.eeeeeeee....eeeee...hhhhhhhhh......eeeeeeeeeeee...eeeeeeeee.hhhhhhhhhhhhhh..... ........eeeeeeee..hhhhhhhh....hhhhhhhhhhhhhhh...eeeeeeeeeee..hhhhhhhhhhhh........eeeeeeehhhhhhhhhhhhhhhhhh.........eeeeee..hhhhhhhhhh............eeeeeee.hhh............eeeeeee....... ..hhhhhhhhhhhhhhhhhhhh....ee......hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhh...
sequence :  ..ALALDGKLRTDSNATAAASTDFGNITSALPAAVLYPSSTGDLVALLSAANSTPGWPYTIAFRGRGHSLMGQAFAPGGVVVNMASLGDAAAPPRINVSADGRYVDAGGEQVWIDVLRASLARGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITGHGEMVTCSKQLNADLFDAVLGGLGQFGVITRARIAVEPAPARARWVRFVYTDFAAFSADQERLTAPR... ..SFGPMSYVEGSVFVNQSLATDLANTGFFTDADVARIVALAGERNATTVYSIEATLNY..AAVDQELASVLGTLSYVEGFAFQRDVAYAAFLDRVHGEEVALNKLGLWRVPHPWLNMFVPRSRIADFDRGVFKGILQGTDIVGPLIVYPLNKSMWDDGMSAATPSEDVFYAVSLLFSS... ..NDLARLQEQNRRILRFCDLAGIQYKTYLARHTDRSDWVRHFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN
seq num:  ..40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270 ... ..280       290       300       310       320       330    ..344       354       364       374       384       394       404       414       424       434       444       454     ... ..465       475       485       495       505       515       525       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. || ||||| | ^***|  |  |^***| |       |  |     ||| ||  | |      ||||  | ||   |    | || ||      ^***||||   |  |        || |||  ||  |  | | | |  ||          ||||||      | |||    | ||| |  | |||||| |                         |   |   | | ||  ..PS00001..| | ||  |     ^***      |||||  ||         |^***          ..          |  || |||||                       ||||                     |   |||| |           ^***|| || | || |            ..PS00001..                   | |   |  |  |||  |                     ||||   |||| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. || ||||| |     |  |  |||| | |       |  |     ||| ||  | |      ||||  | ||   |    | || ||        | ||||   |  |        || |||  ||  |  | | | |  ||          ||||||      | |||    | ||| |  | |||||| |                         |   |   | | ||  ..PS00005..| | ||  |               |||||  ||         | |            ..          |  || |||||                       ||||                     |   |||| |            || || || | || |            ..PS00005..                   | |   |  |  ^**  |                     ||||   |||| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. || ||||| |     |  |  |||| | |       ^***     ||| ||  | |      ||||  | ||   |    | ^***|        | ||||   |  |        || |||  |^***  | | | |  ||          ||||||      | |||    | ||| |  | |||||| |                         |   |   | | ||  ..PS00006..| | |^***               ||||^***|         | |            ..          |  |^***|||                       ||||                     |   |||| |            |^*** || | ^***            ..PS00006..                   | |   |  |   |   |                     ||||   |||| 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. || ||||| |     |  |  |||| | |                ||| ||  | |      ||||  | ||   |    |  |  |        | ||||   |  |        || |||  *******^ | | |  ||          ||||||      | |||    | ||| |  | |||||| |                         |   |   | | ||  ..PS00007..| | |   |               |||||   |         | |            ..          |  |  | |||                       ||||                     |   |||| |            |  || || | || |            ..PS00007..                   | |   |  |   |   |                     ||||   |||| 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. || ||||| |     |  |  ^***** |                ||| ||  | |      ||||  | ||   ^*****  |  |        | ||||   |  |        || |||      |    | ^*****|          ||||||      | |||    | ||| |  | |||||| |                         |   |   | | ||  ..PS00008..* | |   |               |||||   |         | |            ..          |  |  | |||                       ||||                     ^*****|| |            |  || ^*****| |            ..PS00008..                   | |   |  |   |   |                     ||||   |||| 
search RasMol script viewer Motif-ligand binding stats  OX2_COVAL_FAD .. || ||||| |     |  |  ||||   ************************************^|  | ||           |  |        | ||||   |  |        || |||      |    |   |  ||          ||||||      | |||    | ||| |  | |||||| |                         |   |   | | ||  ..PS00862..  | |   |               |||||   |         | |            ..          |  |  | |||                       ||||                         | || |            |  || || |  | |            ..PS00862..                   | |   |  |   |   |                     ||||   |||| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. || ||||| |     |  |  ||||                    ||| ||  | |      ||||  | ||           |  |        | ||||   |  |        || |||      |    |   *****          ||||||      | |||    | ||| |  | |||||| |                         |   |   | | ||  ..alphabetamotif..  | |   |               |||||   |         | |            ..          |  |  | |||                       ||||                         | || |            |  || || |  | |            ..alphabetamotif..                   | |   |  |   |   |                     ||||   |||| 
search RasMol script viewer Motif-ligand binding stats  asxmotif .. || ||||| |     |  |  ||||                    ||| ||  | |      ||||  | ||           |  |        | ||||   |  |        || |||      |    |   |  |           ||||||      | |||    | ||| |  | |||||| |                         *****   | | ||  ..asxmotif..  | |   |               |||||   |         | |            ..          |  |  | |||                       ||||                         | || |            |  || || |  | |            ..asxmotif..                   | |   |  |   *****                     ||||   |||| 
search RasMol script viewer Motif-ligand binding stats  asxturn .. || ||||| |     |  |  ||||                    ||| ||  | |      ||||  | ||           |  |        | ||||   |  |        || |||      |    |   |  |           ||||||      | |||    | ||| |  | |||||| |                                 | | ||  ..asxturn..  | |   |               |||||   |         | |            ..          |  |  | |||                       ||||                         | || |            |  |***| |  | |            ..asxturn..                   | |   |  |                             ||||   |||| 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. || ||||| |     |  |  ||||                    ||| ||  | |      ||||  | ||           |  |        | ||||   |  |        || |||      |    |   |  |           ||||||      *****    | ||| |  | |||||| |                                 | | ||  ..betabulgeloop..  | |   |               |||||   |         | |            ..          |  |  | |||                       ||||                         | || |            |  ||  | |  | |            ..betabulgeloop..                   | |   |  |                             ||||   |||| 
search RasMol script viewer Motif-ligand binding stats  betaturn .. |****||| |     |  |  ||||                    ||| ||  | |      ||||  | ||           |  |        ****||   ****        *****|      |    |   ****           *****|      ****|    | ||| |  | ****|| |                                 | | ||  ..betaturn..  | |   |               |||||   |         | |            ..          ****  ****|                       ||||                         | || |            ****|  | |  | |            ..betaturn..                   | |   |  |                             ||||   |||| 
search RasMol script viewer Motif-ligand binding stats  nest .. |  ****| |     |  |  ****                    ||| ||  | |      ****  ***|           |  |          ****   |  |           ***      |    |   |                |  |      | ***    | ||***  |  |******                                 | | ||  ..nest..  | |   |               ****|   |         ***            ..          |  |    ***                       ****                         | || |            |  ||  | |  | |            ..nest..                   ***   |  |                             ****   **** 
search RasMol script viewer Motif-ligand binding stats  niche .. |   ******     ****                          ||*********       ***  ****           ****                 ****                    |    |   |                ****      | | |    ****     ****                                       | ****  ..niche..  ***   |               |***|   |                        ..          ****    ***                                                    ******            **********  ***            ..niche..                         ****                              ***        
search RasMol script viewer Motif-ligand binding stats  schellmannloop .. ******                                       ||  ||             |                                                               |    |   |                          | | |    | |                                                 |   |   ..schellmannloop..        |               | | |   |                        ..                                                                                                                      ..schellmannloop..                                                                      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                              ||  ||             |                                                               |    |   |                          *****    | |                                                 |   |   ..stmotif..        |               | | *****                        ..                                                                                                                      ..stmotif..                                                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                              ******             |                                                               |    *****                          | |      | |                                                 *****   ..ststaple..        |               | |                              ..                                                                                                                      ..ststaple..                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                 |                                                               |                                   ***      ***                                                         ..stturn..        |               ***                              ..                                                                                                                      ..stturn..                                                                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                 *                                                               *                                                                                                        ..REP00000..        *                                                ..                                                                                                                      ..REP00000..                                                                      

   New search    1w1o:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors