triangle PDBeMotif: 1uae  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.5.1.7
Classification transferase    | release date: Mon, Sep 30, 1996
Title structure of udp-n-acetylglucosamine enolpyruvyl transferase
Authors T.SKARZYNSKI
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search UD1 UD1 binding statistics UD1   search FFQ FFQ binding statistics FFQ
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MDKFRVQGPTKLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDVDTSMKLLSQLGAKVERNGSVHIDARDVNVF
CAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCTIGARPVDLHISGLEQLGATIKLEEGYVKASVDGRLKGAHIVMDK
VSVGATVTIMCAATLAEGTTIIENAAREPEIVDTANFLITLGAKISGQGTDRIVIEGVERLGGGVYRVLPDRIETGTFLV
AAAISRGKIICRNAQPDTLDAVLAKLRDAGADIEVGEDWISLDMHGKRPKAVNVRTAPHPAFPTDMQAQFTLLNLVAEGT
GFITETVFENRFMHVPELSRMGAHAEIESNTVICHGVEKLSGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYE
RIEDKLRALGANIERVKGE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE
member of: CATH:search3.65.10.10GENE3D:searchG3DSA_3.65.10.10HAMAP:searchMF_00111PANTHER:searchPTHR21090/searchPTHR21090_SF4PFAM:searchPF00275SUPERFAMILY:searchSSF55205TIGRFAMS:searchTIGR01072UniProt:searchP0A749
JMol viewer RasMol script viewer  FFQ 421A  ..                     *                                                                    *                      ** *  *                                                                                                                                                                                                                                                                                    *                     
JMol viewer RasMol script viewer  UD1 420A  ..                     |*                                                                   *   *                  || |  ******                                  * ***                                                                                                                                           **                     **                                                                    |                     
sec str:  ....eeeeee....eeeee....hhhhhhhhhhhhh....eeee.....hhhhhhhhhhhh...eeee...eeee..........hhhhhh..hhhhhhhhhhhhh.eeeee............hhhhhhhhh...eeeee..eeeee........eee.....hhhhhhhhhhhhh...eeeee.....hhhhhhhhhhhh...eee.....eeeee.......eeee....hhhhhhhhhhhhh...eeeee...hhhhhhhhhhhhh...eeee...eeeee....................hhhhhhhhhhhhh...eeeee........hhhhhhhhh...eeee..eeeee........eee...hhhhhhhhhhhhh..eeeeee.hhhhhh....hhhhhhhh..eeeee..
sequence :  ..MDKFRVQGPTKLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDVDTSMKLLSQLGAKVERNGSVHIDARDVNVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCTIGARPVDLHISGLEQLGATIKLEEGYVKASVDGRLKGAHIVMDKVSVGATVTIMCAATLAEGTTIIENAAREPEIVDTANFLITLGAKISGQGTDRIVIEGVERLGGGVYRVLPDRIETGTFLVAAAISRGKIICRNAQPDTLDAVLAKLRDAGADIEVGEDWISLDMHGKRPKAVNVRTAPHPAFPTDMQAQFTLLNLVAEGTGFITETVFENRFMHVPELSRMGAHAEIESNTVICHGVEKLSGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIERVKG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                   |  | |    ||||||     |  |   |   || | || |||    ^***   |  | | |       | | |  |       | |       ||   |       | || |||| | |  |                     |    |   || ||  | || || |       | |||||| | || | |                  | | |     |   | |   |  |           || |||           ||||||              |||||      |  |       || ||  |  |  |  | |                           |   |    |  |   |  || |  || | | |  || |||       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                   |  | |    ||||||     |  |   |   |^** || |||    | |    |  | | |       ^** |  |       | |       ||   |       | || |||^** |  |                     |    |   || ||  | || || |       | |||||| | || ^**                  | | |     |   | |   |  |           || |||           ||||||              |||||      |  |       || ||  |  |  |  | |                           |   |    |  |   |  || |  || | | |  || |||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                   |  | |    ||||||     |  |   |   |    || |||    | |    |  | | |           |  |       | |       ||   |       ^*** |||    |  |                     |    |   |^***  ^*** || |       | |||||| | || | |                  | | |     |   | |   |  |           || |||           ||||||              |||||      |  |       |^***  |  |  |  | |                           |   |    |  |   ^***| |  || | | |  || |||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                   ^*****    ||||||     |  |   |   |    || |||    | |    |  | | |           |  |       | |       ^*****         || |||    |  |                     ^*****   |  |     |  || |       | ||||^*****| | |                  | | |     |   | |   |  |           || |||           ||||||              |||||      |  |       |  |   |  |  |  | |                           |   |    |  |       | |  || | | |  || |||       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                      |      ||||||     |  |   |   |    || |||    | |    |  | | |           |  |       | |        |             || |||    |  |                              |  |     |  || |       | |||||| | || | |                  | | |     |   | |   |  |           || |||           ||^***              |||||      |  |       |  |   |  |  |  | |                           |   |    |  |       | |  || | | |  || |||       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                      |      ||||||     |  |   |   |    || |||    | |    |  | | |           |  |       | |        |             || |||    |  |                              |  |     |  || |       | |||||| | || | |                  *****     |   | |   |  |           || |||           |||||               |||||      |  |       |  |   |  |  |  | |                           |   |    |  |       | |  || | | |  || |||       
search RasMol script viewer Motif-ligand binding stats  asxturn ..                      |      ||||||     |  |   |   |    || |||    | |    |  | | |           |  |       | |        |             || |||    |  |                              |  |     |  || |       | |||||| | || | |                  *** |     |   | |   |  |           || |||           ***||               |||||      |  |       |  |   |  |  |  | |                           |   |    |  |       | |  || | | |  || |||       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      |      ******     |  |   |   |    |****|    | |    |  | | |           ****       | |        |             |****|    ****                              |  |     |  || |       | |****| | **** |                  |   |     |   | |   |  |           |****|            ****               *****      |  |       |  |   ****  **** |                           |   |    |  |       | ****| | | |  *****|       
search RasMol script viewer Motif-ligand binding stats  nest ..                      |        |  |     |  |   |   |    |  ***    | |    |  | | |                      ***        |             |  ***                                      |  |     |  || |       | | |*** | || | |                  |   |     |   ***   |  |           |  ***            ***                  |        |  |       |  |            ***                           |   |    |  |       ***  || | ***  |  ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                      |        ****     ****   |   |    |    |    ***    **** ***                                 |             |    |                                      ****     *******       | | |  | ****** |                  |   |     |   |     ****           |    |                                 |        ****       ****                                          |   |    ****            ****      |    |       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                      |                        |   |    ******                                                    |             ******                                                             | ******      | |                  |   |     |   |                    ******                                 |                                                                 |   |                     |        ******       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                      |                        *****                                                              |                                                                                *****         | |                  *****     *****                                                           |                                                                 *****                     |                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                      |                                                                                           |                                                                                              ***                                                                                            |                                                                                           |                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                      *                                                                                           *                                                                                                                                                                                             *                                                                                           *                     

   New search    1uae:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML