triangle PDBeMotif: 1u54  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.1.112
Classification transferase    | release date: Mon, Jul 26, 2004
Title crystal structures of the phosphorylated and unphosphorylate domains of the cdc42-associated tyrosine kinase ack1 bound
Authors J.C.LOUGHEED, P.MAK, R.H.CHEN, T.J.STOUT
Method X-RAY DIFFRACTION (resolution: 2.80Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search ACP ACP binding statistics ACP
Modified residues:  search PTR PTR binding statistics PTR
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GSAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDH
RNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLV
KIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKE
GERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRAEF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ACTIVATED CDC42 KINASE 1
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_2.30.30.40/searchG3DSA_3.30.200.20PANTHER:searchPTHR24418/searchPTHR24418_SF66PFAM:searchPF07714/searchPF14604PRINTS:searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109, PROSITE PROFILES:searchPS50002/searchPS50011, SMART:searchSM00219/searchSM00326SUPERFAMILY:searchSSF50044/searchSSF56112UniProt:searchQ07912
JMol viewer RasMol script viewer  ACP 101A  ..                  * ..  *               * *  ..                                    * *                                                * *          *                    ..ACP ..                                                                                                   
JMol viewer RasMol script viewer  MG 399A  ..                  | ..  |               | |  ..                                    | |                                                | |          *                    ..MG ..                                                                                                   
JMol viewer RasMol script viewer  MG 398A  ..                  | ..  |               | |  ..                                    | |                                                | |          |                    ..MG ..                                                                                                   
sec str:  ......ee.hhh.eee..........eeeeeee.....eeeeeeee....hhhhhhhhhhhhhh.......eeeee.....eeeee.....hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee.......ee........ ...hhhhhhhhhhhhheehhhhhhhhhhhhhhhhh..........hhhhhhhhhh............hhhhhhhhhhhh..hhhhh.hhhhhhhhhhh...
sequence :  ..QSLTCLIGEKDLRLLEKLGD..GVVRRGEWDAPSGKTVSVAVKCL..AMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHR... ..VPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQP
seq num:  ..115       125       ..138       148          ..170       180       190       200       210       220       230       240       250       260       270       280        ... ..292       302       312       322       332       342       352       362       372       382      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       || ||     |  ..           | |      |  ..         |   |  |  |      | |             || |||                |  ||      |||| | |  || | | |  |    ||| |  |             ..PS00001..  |  |  || || |        |   | ||  | | | ||||^***       | |                 |  | ||  | | |    |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       || ||     |  ..           ^**      |  ..         |   |  |  |      | |             || |||                |  ||      ^**| | |  || | | |  |    ||| |  |             ..PS00005..  |  |  |^**| |        |   | ||  | | | ||||   |       | |                 |  | ||  | | |    |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       || ||     |  ..           | |      |  ..         |   |  |  |      | |             ^***||                |  ||       | | | |  || | | |  |    ||| |  |             ..PS00006..  |  |  |   | |        |   ^***  | | | ||||   |       | |                 |  | ||  | | |    |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       || ||     |  ..           | |      |  ..         |   |  |  |      | |              |  ||                |  ||       | | | |  || | | |  |    ||^*****             ..PS00008..  |  |  |   | |        |   | |   | | | ||^*****       | |                 |  | ||  | | |    |  |   
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..       || ||     ***..*********************  ..         |   |  |  |      | |              |  ||                |  ||       | | | |  || | | |  |    ||| |                ..PS00107..  |  |  |   | |        |   | |   | | | || |           | |                 |  | ||  | | |    |  |   
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_TYR ..       || ||        ..           | |         ..         |   |  |  |      | |              |  ||                |  ||       | ****^******** |  |    ||| |                ..PS00109..  |  |  |   | |        |   | |   | | | || |           | |                 |  | ||  | | |    |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       || ||        ..           | |         ..         |   |  |  |      | |              *****                *****       | | | |  || |   |  |    ||| |                ..alphabetamotif..  |  |  |   | |        |   | |   | | | || |           | |                 |  | ||  | | |    |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..       || ||        ..           | |         ..         |   |  |  |      | |              |  |                 |  |        | | | |  || |   |  |    *** |                ..asxturn..  |  |  |   | |        |   | |   | | | || |           | |                 |  | ||  | | |    |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|        ..           | |         ..         |   |  ****      | |              ****                 ****        | | | |  || |   |  |     |  |                ..betaturn..  |  |  |   | |        |   | |   | | | ****           | |                 **** |**** | |    ****   
search RasMol script viewer Motif-ligand binding stats  nest ..        |  |        ..           ***         ..         |   |  |  |      | |                                               *** ***  || |   |  |     |  |                ..nest..  |  |  |   ***        |   | |   *** | || |           ***                 |  | ||  | | |           
search RasMol script viewer Motif-ligand binding stats  niche ..        ****        ..                       ..         |   |  ****      ***                                                     |  ****   ****     ****                ..niche..  ****  |   |          |   | |   |   ******                               ********** | |           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                    ..                       ..         *****                                                                    |   |                                  ..ststaple..        *****          ***** *****                                                   | |           
search RasMol script viewer Motif-ligand binding stats  stturn ..                    ..                       ..                                                                                  |   |                                  ..stturn..                                                                                     ***           
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                    ..                       ..                                                                                  *   *                                  ..REP00000..                                                                                                   

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : ACTIVATED CDC42 KINASE 1
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_2.30.30.40/searchG3DSA_3.30.200.20PANTHER:searchPTHR24418/searchPTHR24418_SF66PFAM:searchPF07714/searchPF14604PRINTS:searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109, PROSITE PROFILES:searchPS50002/searchPS50011, SMART:searchSM00219/searchSM00326SUPERFAMILY:searchSSF50044/searchSSF56112UniProt:searchQ07912
JMol viewer RasMol script viewer  ACP 400B  ..               ** ..  *               * *  ..                                     ***   *                                           *  *          *                                                                                                                      
JMol viewer RasMol script viewer  MG 399B  ..               || ..  |               | |  ..                                     |||   |                                           |* |          *                                                                                                                      
JMol viewer RasMol script viewer  MG 398B  ..               || ..  |               | |  ..                                     |||   |                                           || |          |                                                                                                                      
sec str:  ....ee.....eeeeeeee.....eeeeeee.....eeeeeeee.....hhhhhhhhhhhhhh.......eeeee.....eeeee....eehhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhee....hhh.eee.....eee......ee.......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhhh........hhhhhhhhhhh...........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhh
sequence :  ..LTCLIGEKDLRLLEKLGD..GVVRRGEWDAPSGKTVSVAVKCL..EAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEA
seq num:  ..117       127     ..138       148          ..169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     || ||     |  ..           | |      |  ..| |       | | || |  |   || | |             |  |                             |||| | |  || | | | ||    ||| |  |         |  |   |  |  || || | ||  || |   | ||  | | | ||||^***       | |    |  |   |  || |  | ||  | |   |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     || ||     |  ..           ^**      |  ..| |       | | || |  |   || | |             |  |                             ^**| | |  || | | | ||    ||| |  |         |  |   |  |  |^**| | ||  || |   | ||  | | | ||||   |       | |    |  |   |  || |  | ||  | |   |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     || ||     |  ..           | |      |  ..* |       | | || |  |   || | |             ^***                              | | | |  || | | | ||    ||| |  |         |  |   |  |  |   | | ||  || |   ^***  | | | ||||   |       | |    |  |   |  || |  | ||  | |   |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     || ||     |  ..           | |      |  ..| |       | | || |  |   || | |                                               | | | |  || | | | ||    ||^*****         |  |   |  |  |   | | ||  || |   | |   | | | ||^*****       | |    |  |   |  || |  | ||  | |   |       
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..     || ||     ***..*********************  ..| |       | | || |  |   || | |                                               | | | |  || | | | ||    ||| |            |  |   |  |  |   | | ||  || |   | |   | | | || |           | |    |  |   |  || |  | ||  | |   |       
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_TYR ..     || ||        ..           | |         ..| |       | | || |  |   || | |                                               | ****^******** | ||    ||| |            |  |   |  |  |   | | ||  || |   | |   | | | || |           | |    |  |   |  || |  | ||  | |   |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     || ||        ..           | |         ..| |       | | || |  |   || | |                                               | | | |  || |   | ||    ||| |            |  |   |  |  |   | | ||  || |   | |   | | | || |           | |    |  |   ***** |  | ||  | |   |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..     || ||        ..           | |         ..| |       | | || |  |   ** | |                                               | | | |  || |   | ||    ||| |            |  |   |  |  |   | | ||  || |   | |   | | | || |           | |    |  |   |  |  |  | ||  | |   |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****|        ..           | |         ..| |       | | || |  |      | |                                               | | | |  || |   | ||    ||| |            |  |   ****  |   | | ||  || |   | |   | | ******           | |    |  |   ****  |  | ||  | |   |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      |  |        ..           | |         ..***       | | || |  |      | |                                               | | | |  || |   | ||    ||| |            |  |   |  |  |   | | ||  || |   | |   | | | || |           | |    |  |         |  | ||  | |   |       
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |        ..           ***         ..          | | || |  |      | |                                               *** ***  || |   | ||    *** |            |  |   |  |  |   *** ||  || |   | |   *** | || |           ***    |  |         |  | ||  | |   |       
search RasMol script viewer Motif-ligand binding stats  niche ..      ****        ..                       ..          | **** ****      ***                                                     |  ****   ****     ****            ****   ****  |   |   ||  || |   | |   |   ******                  ****         ********** |   |       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                  ..                       ..          |   |                                                                    |   |     | |                                   |   |   *****| |   | |   |                                                   *****       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                  ..                       ..          *****                                                                    |   |     | |                                   *****    ***** ***** *****                                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                  ..                       ..                                                                                   |   |     ***                                                                                                                            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                  ..                       ..                                                                                   *   *                                                                                                                                    

   New search    1u54:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML