triangle PDBeMotif: 1tnf  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification lymphokine    | release date: Fri, Aug 25, 1989
Title the structure of tumor necrosis factor-alpha at 2.6 angstroms resolution. implications for receptor binding
Authors M.J.ECK, S.R.SPRANG
Method X-RAY DIFFRACTION (resolution: 2.60Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTI
SRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLLFAESGQVYFGIIAL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR NECROSIS FACTOR-ALPHA
member of: CATH:search2.60.120.40GENE3D:searchG3DSA_2.60.120.40PANTHER:searchPTHR11471/searchPTHR11471_SF23PFAM:searchPF00229PRINTS:searchTNECROSISFCT/searchTNFALPHAPROSITE PATTERNS:searchPS00251, PROSITE PROFILES:searchPS50049, SMART:searchSM00207SUPERFAMILY:searchSSF49842UniProt:searchP01375
sec str:  ........eeeeeee.................eee...eee..eeee...eeeeeeeeeeeeeee.......eeeeeeeee...eeeeeeeeeee.............eeeeeeeeeeeeeee..eeeeeeee.hhhhh.......eeeeeeee
sequence :  ..RTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLLFAESGQVYFGIIAL
seq num:  ..6         16        26        36        46        56        66        76        86        96        106       116       126       136       146         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*| ^**                  | |     | |       |               |   |    |                                    | |      |       |  |        |  |    | |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***                   | |     | |       |               |   |    |                                    | |      |       |  |        |  |    | |        
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                        | |     | |       |               |   |    |                                    | *******^       |  |        |  |    | |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                        | |     | |       |               |   ^*****                                    | |              |  |        |  |    | |        
search RasMol script viewer Motif-ligand binding stats  TNF_1 ..                        | |     | |       *****************                                             | |              |  |        |  |    | |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                        ***     ***                                                                     ***              |  |        |  |    ***        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                                                                         ****        ****               

chain B : TUMOR NECROSIS FACTOR-ALPHA
member of: CATH:search2.60.120.40GENE3D:searchG3DSA_2.60.120.40PANTHER:searchPTHR11471/searchPTHR11471_SF23PFAM:searchPF00229PRINTS:searchTNECROSISFCT/searchTNFALPHAPROSITE PATTERNS:searchPS00251, PROSITE PROFILES:searchPS50049, SMART:searchSM00207SUPERFAMILY:searchSSF49842UniProt:searchP01375
sec str:  ........eeeeeee.................eee...eee..eeee...eeeeeeeeeeeeeee.......eeeeeeeee...eeeeeeeeeee.............eeeeeeeeeeeeeee..eeeeeeee.hhhhh.......eeeeeeee
sequence :  ..RTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLLFAESGQVYFGIIAL
seq num:  ..6         16        26        36        46        56        66        76        86        96        106       116       126       136       146         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*| ^**       |  |                     | | |               |   |    |            | |    ||    | |          |      |       |  |        |  |               
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***        |  |                     | | |               |   |    |            | |    ||    | |          |      |       |  |        |  |               
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..             |  |                     | | |               |   |    |            | |    ||    | |          *******^       |  |        |  |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             |  |                     | | |               |   ^*****            | |    ||    | |                         |  |        |  |               
search RasMol script viewer Motif-ligand binding stats  TNF_1 ..             |  |                     | | *****************                     | |    ||    | |                         |  |        |  |               
search RasMol script viewer Motif-ligand binding stats  betabulge ..             |  |                     | |                                       | |    **    | |                         |  |        |  |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..             |  |                     | |                                       | |          | |                         ****        |  |               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             |  |                     ***                                       ***          | |                         |  |        |  |               
search RasMol script viewer Motif-ligand binding stats  niche ..             ****                                                                            ***                         ****        ****               

chain C : TUMOR NECROSIS FACTOR-ALPHA
member of: CATH:search2.60.120.40GENE3D:searchG3DSA_2.60.120.40PANTHER:searchPTHR11471/searchPTHR11471_SF23PFAM:searchPF00229PRINTS:searchTNECROSISFCT/searchTNFALPHAPROSITE PATTERNS:searchPS00251, PROSITE PROFILES:searchPS50049, SMART:searchSM00207SUPERFAMILY:searchSSF49842UniProt:searchP01375
sec str:  ........eeeeeee.................eee...eee..eeee...eeeeeeeeeeeeeee.......eeeeeeeee...eeeeeeeeeee.............eeeeeeeeeeeeeee..eeeeeeee.hhhhh.......eeeeeeee
sequence :  ..RTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLLFAESGQVYFGIIAL
seq num:  ..6         16        26        36        46        56        66        76        86        96        106       116       126       136       146         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*| ^**       | | |     |  |           | | |  | |          |   |    |                                      |      |       |  |        |  |    | |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***        | | |     |  |           | | |  | |          |   |    |                                      |      |       |  |        |  |    | |        
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..             | | |     |  |           | | |  | |          |   |    |                                      *******^       |  |        |  |    | |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             | | |     |  |           | | |  | |          |   ^*****                                                     |  |        |  |    | |        
search RasMol script viewer Motif-ligand binding stats  TNF_1 ..             | | |     |  |           | | *****************                                                              |  |        |  |    | |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..             *** |     |  |           | |    | |                                                                         |  |        |  |    | |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..               | |     |  |           | |    | |                                                                         ****        |  |    | |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               ***     |  |           ***    ***                                                                         |  |        |  |    ***        
search RasMol script viewer Motif-ligand binding stats  niche ..                       ****                                                                                              ****        ****               

   New search    1tnf:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML