triangle PDBeMotif: 1sur  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   1.8.99.4
Classification oxidoreductase    | release date: Wed, Apr 1, 1998
Title phospho-adenylyl-sulfate reductase
Authors H.SAVAGE, I.SINNING
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SKLDLNALNELPKVDRILALAETNAELEKLDAEGRVAWALDNLPGEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGY
LFPETYRFIDELTDKLKLNLKVYRATESAAWQEARYGKLWEQGVEGIEKYNDINKVEPMNRALKELNAQTWFAGLRREQS
GSRANLPVLAIQRGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLWDEGYLSVGDTH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PAPS REDUCTASE
member of: CATH:search3.40.50.620GENE3D:searchG3DSA_3.40.50.620HAMAP:searchMF_00063PANTHER:searchPTHR23293/searchPTHR23293_SF0PFAM:searchPF01507SUPERFAMILY:searchSSF52402TIGRFAMS:searchTIGR00434/searchTIGR02057UniProt:searchP17854
sec str:  ......hhhhhh..hhhhhhhhhhhhhhhhh..hhhhhhhhhhh...eeeee......hhhhhhhhhhh....eeeeee.....hhhhhhhhhhhhh...eeeeee....hhhhhhhh..hhh.hhhhhhhhhhhh.hhhhhhhhhh..eeeee................eeee..eeee.......hhhhhhhhhhh.....hhhhh.........
sequence :  ..SKLDLNALNELPKVDRILALAETNAELEKLDAEGRVAWALDNLPGEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDKLKLNLKVYRATESAAWQEARYGKLWEQGVEGIEKYNDINKVEPMNRALKELNAQTWFAGLRREQSGSRANLPVLAIQRGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLWDEGYLSVGDTH
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |   |  |           |  ||  |         |  |       ||||    |        |  |      ||||   | |     | || |                                               | |    | ||  | | |  |     |  |     |  ||^***      | |    || ||| |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |   |  |           |  ||  |         |  |       ||||    |        |  |      ||||   ^**     ^**| |                                               | |    | ||  | | |  |     |  |     |  ||   |      | |    || ||| |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***   |  |           ^***|  |         |  |       ||||    |        |  |      ||||              | |                                               | |    | ||  | | |  |     |  |     |  ||   |      | |    || ||| ^***  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |   |  |               |  |         |  |       |||^*****        |  |      ||||              | |                                               | |    | ||  | ^*****     |  |     |  ||   |      | |    || |||       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   *****  |               |  |         |  |       ||||             |  |      ||||              | |                                               | |    | ||  | | |  |     |  |     |  |*****      | |    || |||       
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****               |  |         |  |       ||||             ****      ||||              | |                                               | |    | ||  | | |  |     ****     ****           | |    *****|       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       |  |               |  |         |  |       ||||             |  |      ||||              | |                                               | |    | ||  *** |  |              |  |           | |    |  | |       
search RasMol script viewer Motif-ligand binding stats  nest ..       |  |               |  |         |  |       |***             |  |      ****              ***                                               ***    | ||  |   |  |              |  |           ***    |  ***       
search RasMol script viewer Motif-ligand binding stats  niche ..       ****               ****         ****       | |              ****                                                                                 *******   ****              ****                  |    |       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                  | |                                                                                                                                                     ******       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                  ***                                                                                                                                                                  

   New search    1sur:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML