triangle PDBeMotif: 1spr  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification transferase(phosphotransferase)    | release date: Fri, Mar 5, 1993
Title binding of a high affinity phosphotyrosyl peptide to the src sh2 domain: crystal structures of the complexed and peptide-free forms
Authors G.WAKSMAN, J.KURIYAN
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Small molecules:    search PO4 PO4 binding statistics PO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
QAEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSL
QQLVAYYSKHADGLCHRLTNVCPT
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SRC TYROSINE KINASE SH2 DOMAIN
member of: CATH:search3.30.505.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF53PFAM:searchPF00017PFAMB:searchPB005637PRINTS:searchSH2DOMAINPROSITE PROFILES:searchPS50001, SMART:searchSM00252SUPERFAMILY:searchSSF55550UniProt:searchP00524
JMol viewer RasMol script viewer  PO4 105A  ..          *                   * ***     *                 *                                            
sec str:  ...........hhhhhhhhhh........eeeee.......eeeeeeeee...eeeeeeeeeee.....ee.....ee.hhhhhhhhhhhh..............
sequence :  ..AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT
seq num:  ..2         12        22        32        42        52        62        72        82        92           
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  |    |**^* ||  |  ||  |     | ||| |   |  | |   |                  | ||       |  || ||| ||          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |    ^**|^**|  |  ||  |     | ^** |   |  | |   |                  ^**|       |  || ||| ||          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  |    ^***|  |  |  ||  |     | ||  |   ^*** |   |                  |  |       |  || ||| ||          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  |     |  |  |  |  ||  |     | ||  |        |   |                  |  |       |  *****| ||          
search RasMol script viewer Motif-ligand binding stats  asxmotif .. |  |     |  |  |  |  ||  |     | ||  |        *****                  |  |       |  || ||| ||          
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****     *******  ********     | |****                               |  |       *******|****          
search RasMol script viewer Motif-ligand binding stats  nest .. |  |           |  |  ||  |     | ||  |                               |  |           |  |***           
search RasMol script viewer Motif-ligand binding stats  niche .. ****           ***********     | |****                               ****           ****              
search RasMol script viewer Motif-ligand binding stats  stturn ..                                ***                                                                    

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : SRC TYROSINE KINASE SH2 DOMAIN
member of: CATH:search3.30.505.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF53PFAM:searchPF00017PFAMB:searchPB005637PRINTS:searchSH2DOMAINPROSITE PROFILES:searchPS50001, SMART:searchSM00252SUPERFAMILY:searchSSF55550UniProt:searchP00524
sec str:  ............hhhhhhhhhh........eeeee.......eeeeeeeee...eeeeeeeeeee.....ee........hhhhhhhhhhhh..............
sequence :  ..QAEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  |  |    |**^*|||| | |||  |     | ||||    |  |                        ||||     |||||||  || |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |    ^**|^**|| | |||  |     | ^**|    |  |                        ^**|     |||||||  || |           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |    ^***|| || | |||  |     | || |    ^***                        ||||     |||||||  || |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |    |   || || | |||  |     | || |                                ||||     |*****|  || |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |    |   || || ***||  |     | || |                                ||||     |||||||  || |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |    |   ***** |  ||  |     | || |                                ||||     ******|  || |           
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |    |   |  |  |  ||  |     | |***                                ****           |  |***           
search RasMol script viewer Motif-ligand binding stats  niche ..  ****    |   |  ***********     | |                                                  ****              
search RasMol script viewer Motif-ligand binding stats  ststaple ..          *****                  | |                                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                 ***                                                                    

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : SRC TYROSINE KINASE SH2 DOMAIN
member of: CATH:search3.30.505.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF53PFAM:searchPF00017PFAMB:searchPB005637PRINTS:searchSH2DOMAINPROSITE PROFILES:searchPS50001, SMART:searchSM00252SUPERFAMILY:searchSSF55550UniProt:searchP00524
sec str:  ......eee..hhhhhhhhhh.......eeeeee.......eeeeeeeee...eeeeeeeeeee.....ee........hhhhhhhhh............ee...
sequence :  ..AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT
seq num:  ..2         12        22        32        42        52        62        72        82        92           
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. || |    |**^*|||| |  ||  |       | |     |  |                  | |   | ||   |  ||  ||  || |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. || |    ^**|^**|| |  ||  |       ^**     |  |                  | |   ^**|   |  ||  ||  || |           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. || |    ^***|| || |  ||  |               ^***                  | |   |  |   |  ||  ||  || |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. || |    |  |***** |  ||  |                                     | |   |  |   *****  ||  || |           
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****    ********* |  |****                                     | |   |  |   ********|  || |           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  | |           |  |  ||  |                                     ***   |  |   |   |   |  || |           
search RasMol script viewer Motif-ligand binding stats  nest ..  | |           |  |  ||  |                                           |  |   |   |   |  |***           
search RasMol script viewer Motif-ligand binding stats  niche ..  ***           ***********                                           ****   |   |   ****              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                             *****                     

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : SRC TYROSINE KINASE SH2 DOMAIN
member of: CATH:search3.30.505.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF53PFAM:searchPF00017PFAMB:searchPB005637PRINTS:searchSH2DOMAINPROSITE PROFILES:searchPS50001, SMART:searchSM00252SUPERFAMILY:searchSSF55550UniProt:searchP00524
sec str:  ...........hhhhhhhhhh.......eeeeee.......eeeeeeeee...eeeeeeeeeee.....ee........hhhhhhhhhh...........ee...
sequence :  ..AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT
seq num:  ..2         12        22        32        42        52        62        72        82        92           
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..||| |    |**^*|||| |  ||  |       |||| |  |  | | | |                  | ||       |  ||   | ||          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..||| |    ^**|^**|| |  ||  |       ^**| |  |  | | | |                  ^**|       |  ||   | ||          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..||| |    ^*** | || |  ||  |        | | |  ^*** | | |                  |  |       |  ||   | ||          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..||| |         | || |  ||  |        | | |       | | |                  |  |       *****   | ||          
search RasMol script viewer Motif-ligand binding stats  betaturn ..|****         **** |  |****        | | |       | | |                  |  |       ****    ****          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..*** |           |  |  ||  |        *****       | ***                  |  |               | |           
search RasMol script viewer Motif-ligand binding stats  nest .. |  |           |  |  ||  |                    | |                    |  |               ***           
search RasMol script viewer Motif-ligand binding stats  niche .. ****           ***********                    ***                    ****                             

   New search    1spr:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML