triangle PDBeMotif: 1sid  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Classification virus    | release date: Tue, Dec 12, 1995
Title murine polyomavirus complexed with 3'sialyl lactose
Authors S.C.HARRISON, T.STEHLE
Method X-RAY DIFFRACTION (resolution: 3.65Å)
PDBe Citation   
Small molecules:    search SIA SIA binding statistics SIA   search BGC BGC binding statistics BGC   search GAL GAL binding statistics GAL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D,E,F sequence:
APKRKAGVSKCETKCTKACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPRMGQPPTPESLTEGGQYYGWSRGIN
LATSDTEDSPGNNTLPTWSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLLDVHGFNKPTDTVNTKGISTPVEGS
QYHVFAVGGEPLDLQGLVTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKLDKDGMYPVEIWHPDPAKNENTRYF
GNYTGGTTTPPVLQFTNTLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDVHHWRGLPRYFKITLRKRWVKNPYP
MASLISSLFNNMLPQVQGQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVDRFGKTKTVFPGN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS COAT PROTEIN VP1
JMol viewer RasMol script viewer  SIA 384E  ..                                                                    *                                                                                                                                                                                                                                                                                                         
JMol viewer RasMol script viewer  GAL 385A  ..                                                             *      |       *                                                                                                                                                                                                                                                                                                 
JMol viewer RasMol script viewer  SIA 384A  ..                                                       *    **      |       |                                                                                                                                                                                                     *    * *                                                                                    
sec str:  ...................hhhhh.......eeeeeeee.............................................eeeeee...........eeeeeeeeeeeeeee.hhhhh........................eeeeeeee....eeee................hhhh........hhhh....eee...........eee.......eeeeeeee.......eeeee...eee..............eeeeeeeeeeee..........eee.eeeeeeeeeeeeee......hhhh.........................................eee....eee.....
sequence :  ..KACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPRMGQPPTPESLTEGGQYYGWSRGINLATSDTEDSPGNNTLPTWSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLLDVHGFNKPTDTVNTKGISTPVEGSQYHVFAVGGEPLDLQGLVTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKLDKDGMYPVEIWHPDPAKNENTRYFGNYTGGTTTPPVLQFTNTLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDVHHWRGLPRYFKITLRKRWVKNPYPMASLISSLFNNMLPQVQGQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVDRFGKTKTVFPG
seq num:  ..17        27        37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377   
search RasMol script viewer Motif-ligand binding stats  PS00001 ..            ||     |  | || ||  |             ||||  |||| | |  |    ||  |   |^***           | | |  |         | |    | || ||        || |||   |  |                           | |   | |  | || | ||||   | | || | | | |  |             |^***|         |  |  | || |||| | |  |   || |           | |          | |      |  |    |                   | ||                     | |         
search RasMol script viewer Motif-ligand binding stats  PS00005 ..            ||     |  | || ||  |             ||||  |||| | |  |    ||  |   || ||           | | |  |         ^**    | || ||        || |||   |  |                           | |   ^**  ^**| | ||||   | | || | | | |  |             |    |         |  |  | || |||| | |  |   || |           | |          ^**      |  |    |                   | ||                     | |         
search RasMol script viewer Motif-ligand binding stats  PS00006 ..            ||     |  | ^***^***             |||^***||| | |  |    |^***   || ||           | | |  |                | |^***        || |||   ^***                           | |        ^*** | ||||   | | || | | | |  |             |    |         |  |  | || |||| | |  |   ^***           | |                   |  |    |                   ^***                     | |         
search RasMol script viewer Motif-ligand binding stats  PS00007 ..            ||     |  |  |  |                ||||   ||| | |  |    ||  |   || ||           | | |  |                | || ||        || |||                                  | |             | ||||   | | *******^ |  |             |    |         |  |  | || |||| | |  |    |             | |                   |  |    |                   | |                      | |         
search RasMol script viewer Motif-ligand binding stats  PS00008 ..            ||     |  |  |  |                ||||   |^*****  ^*****|  |   || ||           | | |  |                | || ||        || |||                                  | |             | ||||   | |  | | | | |  |             ^*****         |  |  | || |||| | |  ^*****             | |                   |  |    |                   | |                      | |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            ||     |  |  |  |                ||||   | | |          |  |   || ||           | | |  |                | || ||        || |||                                  | |             *****|   | |  | | | | |  |                            |  |  | || |||| | |                     | |                   |  |    |                   | |                      | |         
search RasMol script viewer Motif-ligand binding stats  asxturn ..            ||     |  |  |  |                ||||   | | |          |  |   || ||           | | |  |                | || ||        || |||                                  | |             | || |   | |  | | | | |  |                            |  |  | |***||| | |                     | |                   |  |    |                   | |                      ***         
search RasMol script viewer Motif-ligand binding stats  betabulge ..            **     |  |  |  |                ||||   | | |          |  |   || ||           | | |  |                | || ||        || |||                                  | |             | || |   | |  | | | | |  |                            |  |  | |  |||| | |                     | |                   |  |    |                   | |                                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   ****  |  |                ||||   | | |          ****   ****|           | | |  |                *******        |****|                                  | |             ******   | |  | | | | |  |                            |  |  | |  |||| | |                     | |                   ****    |                   | |                                  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   |  |  |  |                ***|   | | |          |  |    |  |           | | |  |                | ||  |        |  | |                                  | |                      ***  | | | | |  |                            |  |  | |  |||| ***                     | |                      |    |                   | |                                  
search RasMol script viewer Motif-ligand binding stats  nest ..                   |  |  |  |                 | |   *****          |  |    |  |           | | |  |                ***|  |        |  ***                                  | |                           | | *** |  |                            |  |  | |  ****                         | |                      |    |                   | |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..                   ****  ****                 ***     ***          ****    ****           *** ****                   ****        |    |                                  ***                           ***     ****                            ****  ***                               ***                      |    |                   ***                                  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                                                 ******                                                                                                                                                                         |    |                   | |                                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                                                                                                                                                                                ******                   | |                                  
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                                                                                                                         ***                                  

chain B : POLYOMAVIRUS COAT PROTEIN VP1
JMol viewer RasMol script viewer  BGC 386B  ..                                                                                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  GAL 385B  ..                                                            **              *                                                                                                                                                                                                                                                                                                  
JMol viewer RasMol script viewer  SIA 384B  ..                                                       *    **              |                                                                                                                                                                                                     *    * *                                                                                     
JMol viewer RasMol script viewer  SIA 384A  ..                                                       |    ||      *       |                                                                                                                                                                                                     |    | |                                                                                     
sec str:  .........eeeee.eee.hhhhh.......eeeeeeee.............................................eeeeee...........eeeeeeeeeeeeeee.hhhhh........................eeeeeeee....eeee................hhhh........hhhh....eee...........eee.......eeeeeeee.......eeeee....................eeeeeeeeeeee..........eee.eeeeeeeeeeeeee....hhhhhhhhhhh....................................eee....eee......
sequence :  ..KACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPRMGQPPTPESLTEGGQYYGWSRGINLATSDTEDSPGNNTLPTWSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLLDVHGFNKPTDTVNTKGISTPVEGSQYHVFAVGGEPLDLQGLVTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKLDKDGMYPVEIWHPDPAKNENTRYFGNYTGGTTTPPVLQFTNTLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDVHHWRGLPRYFKITLRKRWVKNPYPMASLISSLFNNMLPQVQGQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVDRFGKTKTVFPGN
seq num:  ..17        27        37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377    
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                 || ||  | |||  |             ||||  |||||| |  |    ||  |    ^***                  | |       | |    | |||||           | |   |  |                     |  |  | |   | |  | ||   |  ||  | | |    | |                  |^***|         |  |  | || ||||    | |   || |                        | |                | ||||            | ||             | ||              | |
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                 || ||  | |||  |             ||||  |||||| |  |    ||  |                          | |       ^**    | |||||           | |   |  |                     |  |  | |   ^**  ^**|   |  ||  | | |    | |                  |    |         |  |  | || ||||    | |   || |                        ^**                | ||||            | ||             | ||              | |
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                 || ||  ^***^***             |||^***||||| |  |    |^***                          | |              | |^***           | |   ^***                     |  |  | |        ^***   |  ||  | | |    | |                  |    |         |  |  | || ||||    | |   ^***                                           | ||||            ^***             | ||              | |
search RasMol script viewer Motif-ligand binding stats  PS00007 ..                 || ||    | |                ||||   ||||| |  |    |                              | |              | |||||           | |                            |  |  | |               |  ||  | | *******^                  |    |         |  |  | || ||||    | |    |                                             | ||||            | |              | ||              | |
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                 || ||    | |                ||||   |^*****  ^*****                              | |              | |||||           | |                            |  |  | |               |  ||  | |      | |                  ^*****         |  |  | || ||||    | ^*****                                             | ||||            | |              | ||              | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 || ||    | |                ||||   | ||| |                                      | |              | |||||           | |                            |  |  | |               *****  | |      | |                                 |  |  | || ||||    | |                                                  *****|            | |              | ||              | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 || ||    | |                ||||   | ||| |                                      | |              | |||||           | |                            |  |  | |               |  |   | |      | |                                 |  |  | |***|||    | |                                                  | || |            | |              ***|              | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 *****    | |                ||||   | ||| |                                      | |              ******|           | |                            |  |  | |               ****   | |      | |                                 |  |  | |  ||||    | |                                                  **** |            | |              |  |              | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                          | |                ***|   | ||| |                                      | |              | | | |           | |                            |  |  | |                      ***      | |                                 |  |  | |  ||||    ***                                                    |  |            | |              |  |              ***
search RasMol script viewer Motif-ligand binding stats  nest ..                          | |                 | |   ***** |                                      ***              *** | |           ***                            |  |  | |                               ***                                 |  |  | |  ****    | |                                                    |  |            | |              |  |                 
search RasMol script viewer Motif-ligand binding stats  niche ..                          ***                 ***     *****                                                           ***                                          ****  ***                                                                   ****  ***          ***                                                    ****            ***              ****                 

chain C : POLYOMAVIRUS COAT PROTEIN VP1
JMol viewer RasMol script viewer  GAL 385C  ..                                                             *              *                                                                                                                                                                                                                                                                                        
JMol viewer RasMol script viewer  SIA 384C  ..                                                       *    *|              |                                                                                                                                                                                                     *      *                                                                           
JMol viewer RasMol script viewer  SIA 384B  ..                                                       |    ||              |                                                                                                                                                                                                     |      |                                                                           
sec str:  ...................hhhhh........eeeeeee.............................................eeeeee............eeeeeeeeeeeeee.hhhhh........................eeeeeeee....eeee................hhhh........hhhh....eee...........eee.......eeeeeeee................................eeeeeeeeeeeeee......eeeee.eeeeeeeeeeeee.....hhhhhhh..........................................hhh.
sequence :  ..KACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPRMGQPPTPESLTEGGQYYGWSRGINLATSDTEDSPGNNTLPTWSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLLDVHGFNKPTDTVNTKGISTPVEGSQYHVFAVGGEPLDLQGLVTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKLDKDGMYPVEIWHPDPAKNENTRYFGNYTGGTTTPPVLQFTNTLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDVHHWRGLPRYFKITLRKRWVKNPYPMASLISSLFNNMLPQVQGQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVDRF
seq num:  ..17        27        37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367    
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                |  |  | | |||  |              | |  |||| | |  |    ||| |   |^***                            | |    | || || |         | |   |  |                     |  |  | |   | |  | ||   |  ||  | | |    | | |  |    | |      |^***|  |    | | |   | || ||||    | |   || |                        | |     | ||  |     |  |          |  | ||                 | |    
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                |  |  | | |||  |              | |  |||| | |  |    ||| |   || ||                            ^**    | || || |         | |   |  |                     |  |  | |   ^**  ^**|   |  ||  | | |    | | |  |    | |      |    |  |    | | |   | || ||||    | |   || |                        ^**     | ||  |     |  |          |  | ||                 | |    
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                |  |  | ^***^***              | ^***||| | |  |    |^***   || ||                                   | |^*** |         | |   ^***                     |  |  | |        ^***   |  ||  | | |    | | |  |    | |      |    |  |    | | |   | || ||||    | |   ^***                                | ||  |     |  |          |  ^***                 | |    
search RasMol script viewer Motif-ligand binding stats  PS00007 ..                |  |  |   | |                 | |   ||| | |  |    | | |   || ||                                   | || || |         | |                            |  |  | |               |  ||  | | *******^ |  |    | |      |    |  |    | | |   | || ||||    | |    |                                  | ||  |     |  |          |  | |                  | |    
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                |  |  |   | |                 | |   |^*****  ^***** | |   || ||                                   | || || |         | |                            |  |  | |               |  ||  | |      | | |  |    | |      ^*****  |    | | |   | || ||||    | ^*****                                  | ||  |     |  |          |  | |                  | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                |  |  |   | |                 | |   | | |           | |   || ||                                   | || || |         | |                            |  |  | |               *****  | |      | | |  |    | |           |  |    | | |   | || ||||    | |                                       | ||  |     |  |          |  | |                  | |    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                |  |  |   | |                 | |   | | |           | |   || ||                                   | || || |         | |                            |  |  | |               |  |   | |      | | |  |    | |           |  |    | | |   | |*****|    | |                                       | ||  |     |  |          |  | |                  | |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..                |  |  |   | |                 | |   | | |           | |   || ||                                   | || |***         | |                            |  |  | |               |  |   | |      | | |  |    | |           |  |    | | |   | || ||||    | |                                       | ||  |     |  |          |  | |                  | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****  |   | |                 | |   | | |           | |   ****|                                   ******|           | |                            |  |  | |               ****   | |      | | |  |    | |           |  |    | | |   | |****||    | |                                       | |****     ****          |  | |                  | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   |  |   | |                 | |   | | |           | |    |  |                                   | ||  |           | |                            |  |  | |                      ***      | | |  |    | |           |  |    *** |   | |  ||||    | |                                       | |                       |  | |                  | |    
search RasMol script viewer Motif-ligand binding stats  nest ..                   |  |   | |                 | |   *****           | |    |  |                                   ***|  |           ***                            |  |  | |                               *** |  |    | |           |  |      | |   | |  ****    | |                                       | |                       |  | |                  | |    
search RasMol script viewer Motif-ligand binding stats  niche ..                   ****   ***                 ***     ***           ***    ****                                      ****                                          ****  ***                                   ****    ***           ****      | |   ***          ***                                       ***                       ******                  ***    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                               ***                                                                                                                   

chain D : POLYOMAVIRUS COAT PROTEIN VP1
JMol viewer RasMol script viewer  BGC 386D  ..                                                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  GAL 385D  ..                                                             *              *                                                                                                                                                                                                                                                                       
JMol viewer RasMol script viewer  SIA 384D  ..                                                       *    *|              |                                                                                                                                                                                                          * *                                                          
JMol viewer RasMol script viewer  SIA 384C  ..                                                       |    ||              |                                                                                                                                                                                                          | |                                                          
sec str:  ...................hhhhh........eeeeeee.............................................eeeeee...........eeeeeeeeeeeeeee.hhhhh........................eeeeeeee....eeee..........................hhhh......eee...........eee.......eeeeeeee.......eeeee....................eeeeeeeeeeee..........eee.eeeeeeeeeeeeee....hhhhhhhhhhhh........................
sequence :  ..KACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPRMGQPPTPESLTEGGQYYGWSRGINLATSDTEDSPGNNTLPTWSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLLDVHGFNKPTDTVNTKGISTPVEGSQYHVFAVGGEPLDLQGLVTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKLDKDGMYPVEIWHPDPAKNENTRYFGNYTGGTTTPPVLQFTNTLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDVHHWRGLPRYFKITLRKRWVKNPYPMASLISSLFNNMLPQVQGQPMEGENTQVEEVRVYDG
seq num:  ..17        27        37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                || || | | |||  |     ||||       | ||||| | |  |    ||  |   |^***               |  |||       | |    | ||  |         | |||   |  |                                 ||| || ||   |  ||| ||| |      |                  |^***|         | ||  | || |||     | |   || | ||        | |          | |          |  ||   |  |         |  | ||       
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                || || | | |||  |     ||||       | ||||| | |  |    ||  |   || ||               |  |||       ^**    | ||  |         | |||   |  |                                 ^** |^**|   |  ||| ||| |      |                  |    |         | ||  | || |||     | |   || | ||        | |          ^**          |  ||   |  |         |  | ||       
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                || || | ^***^***     ||||       ^***||| | |  |    |^***   || ||               |  |||              | |^***         | |||   ^***                                  |  |^***   |  ||| ||| |      |                  |    |         | ||  | || |||     | |   ^*** ||        | |                       |  ||   |  |         |  ^***       
search RasMol script viewer Motif-ligand binding stats  PS00007 ..                || || |   | |        ||||       | | ||| | |  |    |       || ||               |  |||              | ||  |         | |||                                         |  ||      |  ||| ||| *******^                  |    |         | ||  | || |||     | |    |   ||        | |                       |  ||   |  |         |  | |        
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                || || |   | |        ||||       | | |^*****  ^*****       || ||               |  |||              | ||  |         | |||                                         |  ||      |  ||| |||                           ^*****         | ||  | || |||     | ^*****   ||        | |                       |  ||   |  |         |  | |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                || || |   | |        ||||       | | | | |                 || ||               *****|              | ||  |         | |||                                         *****      *****| |||                                          | ||  | || |||     | |        ||        | |                       *****   |  |         |  | |        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                || || |   | |        ||||       | | | | |                 || ||               *****|              | ||  |         | |||                                         |  |       |  | | |||                                          | ||  | |*****     | |        ||        | |                       |  |    |  |         |  | |        
search RasMol script viewer Motif-ligand binding stats  betabulge ..                || || |   | |        ||||       | | | | |                 || ||               |  | |              | ||  |         | |||                                         |  |       |  | | |||                                          | ||  | || |||     | |        **        | |                       |  |    |  |         |  | |        
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                || || |   | |        ||||       | | | | |                 || ||               ******              | ||  |         | |||                                         |  |       |  | | |||                                          | ||  | || |||     | |                  | |                       |  |    |  |         |  | |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ***** |   | |        ||||       | | | | |                 ****|               **** |              ****  |         ****|                                         ****       **** ****|                                          | ||  | |****|     | |                  | |                       ****    |  |         |  | |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                    | |   | |        ****       *** | | |                  |  |                  | |              | ||  |           | |                                                           ***                                          | ||  | |  | |     | |                  | |                               |  |         |  | |        
search RasMol script viewer Motif-ligand binding stats  nest ..                    | |   | |                       *****                  |  |                  ***              ***|  |           ***                                                                                                        | ||  | |  ***     | |                  | |                               |  |         |  | |        
search RasMol script viewer Motif-ligand binding stats  niche ..                    ***   ***                         ***                  ****                                      ****                                                                                                                      ****  ***          ***                  ***                               ****         ******        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                               ***                                                                                                  

chain E : POLYOMAVIRUS COAT PROTEIN VP1
JMol viewer RasMol script viewer  GAL 385E  ..                                                             **             *                                                                                                                                                                                                                                                                                                  
JMol viewer RasMol script viewer  SIA 384E  ..                                                       *    *||             |                                                                                                                                                                                                     *    * *                                                                                     
JMol viewer RasMol script viewer  SIA 384D  ..                                                       |    |||     *       |                                                                                                                                                                                                     |    | |                                                                                     
sec str:  ...................hhhhh.......eeeeeeee.............................................eeeeee...........eeeeeeeeeeeeee..hhhhh........................eeeeeeee.....eee................hhhh......hhhh....................eee.......eeeeeeee.......eeeee...eee..............eeeeeeeeeeee..........eee..eeeeeeeeeeeee....hhhhhhhhhhhh..................................eee......eee.....
sequence :  ..KACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPRMGQPPTPESLTEGGQYYGWSRGINLATSDTEDSPGNNTLPTWSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLLDVHGFNKPTDTVNTKGISTPVEGSQYHVFAVGGEPLDLQGLVTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKLDKDGMYPVEIWHPDPAKNENTRYFGNYTGGTTTPPVLQFTNTLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDVHHWRGLPRYFKITLRKRWVKNPYPMASLISSLFNNMLPQVQGQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVDRFGKTKTVFPGN
seq num:  ..17        27        37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377    
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                    |   |  ||  |             | ||  |||| | |  |    ||  |   |^***               | || |       | |    | ||  | |         | |   |  |                     |  |        | |  | ||  || |||  | | |    | |                  |^***|               | || ||||    | |   || |           | |          | |     | |   |   | |  |             | ||                                  
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                    |   |  ||  |             | ||  |||| | |  |    ||  |   || ||               | || |       ^**    | ||  | |         | |   |  |                     |  |        ^**  ^**|  || |||  | | |    | |                  |    |               | || ||||    | |   || |           | |          ^**     | |   |   | |  |             | ||                                  
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                    |   ^***^***             | |^***||| | |  |    |^***   || ||               | || |              | |^*** |         | |   ^***                     |  |             ^***  || |||  | | |    | |                  |    |               | || ||||    | |   ^***           | |                  | |   |   | |  |             ^***                                  
search RasMol script viewer Motif-ligand binding stats  PS00007 ..                    |   |                    | |    ||| | |  |    |       || ||               | || |              | ||  | |         | |                            |  |             | |   || |||  | | *******^                  |    |               | || ||||    | |    |             | |                  | |   |   | |  |             | |                                   
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                    |   |                    | |    |^*****  ^*****       || ||               | || |              | ||  | |         | |                            |  |             | |   || |||  | |      | |                  ^*****               | || ||||    | ^*****             | |                  | |   |   | |  |             | |                                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                    |   |                    | |    | | |                 || ||               | || |              | ||  | |         | |                            |  |             | |   |*****  | |      | |                                       | || ||||    | |                  | |                  | |   |   | |  |             | |                                   
search RasMol script viewer Motif-ligand binding stats  asxturn ..                    |   |                    | |    | | |                 || ||               | || |              | ||  ***         | |                            |  |             | |   || ||   | |      | |                                       | |***|||    | |                  | |                  | |   |   | |  |             | |                                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                    |   |                    | |    | | |                 ****|               | || |              ****  |           | |                            ****             | |   *****   | |      | |                                       | |  ||||    | |                  | |                  | |   |   | ****             | |                                   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                    |   |                    ***    | | |                  |  |               | || |              | ||  |           | |                            |  |             | |           ***      | |                                       | |  ||||    | |                  | |                  | |   |   |                  | |                                   
search RasMol script viewer Motif-ligand binding stats  nest ..                    |   |                           *****                  |  |               ******              ***|  |           ***                            |  |             | |                    ***                                       | |  ****    | |                  | |                  | |   |   |                  | |                                   
search RasMol script viewer Motif-ligand binding stats  niche ..                    |   |                             ***                  ****                                      ****                                          ****             ***                    ***                                       ***          ***                  ***                  ***   |   |                  ***                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                    *****                                                                                                                                                                                                                                                                                         *****                                                        

chain F : POLYOMAVIRUS COAT PROTEIN VP1
JMol viewer RasMol script viewer  BGC 386F  ..                                                                                                                                                                                                                                                                                                                                                                  
JMol viewer RasMol script viewer  GAL 385F  ..                                                            *              *                                                                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  SIA 384F  ..                                                      *    *|              |                                                                                                                                                                                                     * *  * *                                                                         
sec str:  ..................hhhhh........eeeeeee.............................................eeeeee............eeeeeeeeeeeeee.hhhhh........................eeeeeeee.....eee................hhhh..............................eee.......eeeeeeee..........................eee...eeeeeeeeeeee..........eee.eeeeeeeeeeeee.....hhhhhhhhhhhh...............eeeeeeeeeeee............
sequence :  ..ACPRPAPVPKLLIKGGMEVLDLVTGPDSVTEIEAFLNPRMGQPPTPESLTEGGQYYGWSRGINLATSDTEDSPGNNTLPTWSMAKLQLPMLNEDLTCDTLQMWEAVSVKTEVVGSGSLLDVHGFNKPTDTVNTKGISTPVEGSQYHVFAVGGEPLDLQGLVTDARTKYKEEGVVTIKTITKKDMVNKDQVLNPISKAKLDKDGMYPVEIWHPDPAKNENTRYFGNYTGGTTTPPVLQFTNTLTTVLLDENGVGPLCKGEGLYLSCVDIMGWRVTRNYDVHHWRGLPRYFKITLRKRWVKNPYPMASLISSLFNNMLPQVQGQPMEGENTQVEEVRVYDGTEPVPGDPDMTRYVD
seq num:  ..18        28        38        48        58        68        78        88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..               | || || | |||  |              | |  |||| | |  |    ||  |   |^***                            | |    | ||  |           | |   |  |                        | |      ||| || ||   |  ||  | | |    | |                  |^***|       | |  |  | || |||       |   || | ||        | |          | |     | |||||||| |  | |         |  | ||                      
search RasMol script viewer Motif-ligand binding stats  PS00005 ..               | || || | |||  |              | |  |||| | |  |    ||  |   |  |                             ^**    | ||  |           | |   |  |                        | |      ^** |^**|   |  ||  | | |    | |                  |    |       | |  |  | || |||       |   || | ||        | |          ^**     | |||||||| |  | |         |  | ||                      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..               | || || ^***^***              | ^***||| | |  |    |^***   |  |                                    | |^***           | |   ^***                        | |       |  |^***   |  ||  | | |    | |                  |    |       | |  |  | || |||       |   ^*** ||        | |                  | |||||||| |  | |         |  ^***                      
search RasMol script viewer Motif-ligand binding stats  PS00007 ..               | || || | | |                 | |  |||| | |  |    ||  |   |  |                                    | ||  |           | |                               | |       |  ||      |  ||  | | *******^                  |    |       | |  |  | || |||       |    |   ||        | |                  | |||||||| |  | |         |  | |                       
search RasMol script viewer Motif-ligand binding stats  PS00008 ..               | || || | | |                 | |  ||^*****  ^*****|  |   |  |                                    | ||  |           | |                               | |       |  ||      |  ||  | |      | |                  ^*****       | |  |  | || |||       ^*****   ||        | |                  | |||||||| |  | |         |  | |                       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..               | || || | | |                 | |  || | |          |  |   |  |                                    | ||  |           | |                               | |       *****      *****  | |      | |                               | |  |  | || |||                ||        | |                  | |||||||| |  | |         |  | |                       
search RasMol script viewer Motif-ligand binding stats  betabulge ..               | || || | | |                 | |  || | |          |  |   |  |                                    | ||  |           | |                               | |       |  |       |  |   | |      | |                               | |  |  | || |||                **        | |                  | |||||||| |  | |         |  | |                       
search RasMol script viewer Motif-ligand binding stats  betaturn ..               ******| | | |                 | ****| | |          ****   ****                                    ****  |           | |                               | |       ****       ****   | |      | |                               | |  |  | |****|                          | |                  | |******| **** |         |  | |                       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                  |  *** | |                 | |   | | |          |  |                                           | ||  |           | |                               ***                         ***      | |                               ***  |  | |  | |                          | |                  | |  |   |    | |         |  | |                       
search RasMol script viewer Motif-ligand binding stats  nest ..                  |  |   | |                 | |   *****          |  |                                           ***|  |           ***                                                                    ***                                 |  |  | |  ***                          | |                  | |  |   |    | |         |  | |                       
search RasMol script viewer Motif-ligand binding stats  niche ..                  ****   ***                 ***     ***          ****                                              ****                                                                                                                      ****  ***                               ***                  ***  |   |    ***         ******                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                                                                                                                                                                                *****                                             

   New search    1sid:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML