triangle PDBeMotif: 1s9k  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription/dna    | release date: Wed, Feb 4, 2004
Title crystal structure of human nfat1 and fos-jun on the il-2 arre1 site
Authors D.WANG, J.C.STROUD, L.CHEN
Method X-RAY DIFFRACTION (resolution: 3.10Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain C sequence:
WPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHR
ITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIV
SLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNML
FVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV
Chain D sequence:
RRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEK
Chain E sequence:
RKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : NUCLEAR FACTOR OF ACTIVATED T-CELLS, CYTOPLASMIC2;
member of: CATH:search2.60.40.10/search2.60.40.340GENE3D:searchG3DSA_2.60.40.10/searchG3DSA_2.60.40.340PANTHER:searchPTHR12533/searchPTHR12533_SF4PFAM:searchPF00554/searchPF01833PFAMB:searchPB003407PRINTS:searchNUCFACTORATCPROSITE PROFILES:searchPS50254, SMART:searchSM00429SUPERFAMILY:searchSSF49417/searchSSF81296UniProt:searchQ13469
sec str:  ............eeeeee...........................eeeee.......eeeeeeee............eeeee............ee.....eeeeeehhhhh.eee...eeeee.hhhhhh.............eeeeeeeeeee.....eeeeeee...ee.hhhhhhhh.eeeee...eee.....eeeeeee......eeeeeee.....eeeeeeeee........eeeee............eeeeeeee.........eeeeee..
sequence :  ..WPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV
seq num:  ..399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579       589       599       609       619       629       639       649       659       669       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..              ||         |  ||    | | |||                      |  |     |  |     | |    |  |             || |||                   |  | ||||||||          | |||           | | |||||    ||      |  |       | ^***||    | || ||| ||     | |                |  |           || ||||          
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..              ||         |  ||    | | |||                      |  |     |  |     | |    |  |             || |||                   |  | |||**^*|          | |||           | | |||||    ||      |  |       |  |||||    | || ||| ||     | |                |  |           || **^*          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..              ||         |  ||    | | |||                      |  |     |  |     ^**    |  |             || |||                   |  | |||||| |          | ^**           | ^**||||    ||      |  |       |  |||||    ^**| ||| ||     | |                |  |           || ||            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              ||         |  ||    | | |||                      ^***     |  |            ^***             || |||                   |  | |||||| |          | |||           | | |^***    ||      |  |       |  |||||       | ||| ||     | |                |  |           || ||            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              ||         |  |^***** | |||                               |  |                             || |||                   |  | |||||| |          | |||           | | | |||    ||      |  |       ^*****||       | ||| ||     | |                |  |           || ||            
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..              ||         |  |       | |||                               |  |                             || |||                   |  | |^***| |          | |||           | | | |||    ||      |  |       |  || ||       | ||| ||     | |                |  |           ^***|            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              ||         |  |       | |||                               |  |                             || |||                   |  | |||| | |          | |||           | | *****    ||      |  |       |  || ||       | ||| ||     | |                |  |            |  |            
search RasMol script viewer Motif-ligand binding stats  betabulge ..              **         |  |       | |||                               |  |                             || |||                   |  | |||| | |          | |||           | | | ||     **      |  |       |  || ||       | ||| **     | |                |  |            |  |            
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                         |  |       | |||                               |  |                             || |||                   |  | |||| | |          *****           | | | ||             |  |       |  || ||       *****        | |                |  |            |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                         |  |       ****|                               |  |                             |****|                   |  | ||**** |          ****|           | | ****             ****       |  || ||       ****|        | |                |  |            ****            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                         |  |         | |                               |  |                             |  | |                   |  | || | | |            | |           | |   |                         |  || ||         | |        ***                |  |                            
search RasMol script viewer Motif-ligand binding stats  nest ..                         |  |         ***                               |  |                             |  ***                   |  | || | | |            ***           | |   |                         |  || ||         ***                           |  |                            
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****         | |                               ****                             |    |                   ********* ***                          ***   |                         ********                                       ****                            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                      | |                                                                ******                                                            |   |                             | |                                                                        
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                      | |                                                                                                                                  *****                             | |                                                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                      ***                                                                                                                                                                    ***                                                                        

chain D : PROTO-ONCOGENE PROTEIN C-FOS
member of: CATH:search1.20.5.170GENE3D:searchG3DSA_1.20.5.170PANTHER:searchPTHR23351/searchPTHR23351_SF4PFAM:searchPF00170PFAMB:searchPB001899PRINTS:searchLEUZIPPRFOSPROSITE PATTERNS:searchPS00036, PROSITE PROFILES:searchPS50217, SMART:searchSM00338SUPERFAMILY:searchSSF57959UniProt:searchP01100
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..RRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEK
seq num:  ..140       150       160       170       180          
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER .. | |||           ||   |  **********************      
search RasMol script viewer Motif-ligand binding stats  BZIP_BASIC .. | ***************|   |  |   | |  ||      |  ||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *****            |   |  |   | *****      *****      
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****             |   |  |   | ****       ****       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                  *****  *****                       

chain E : TRANSCRIPTION FACTOR AP-1
member of: CATH:search1.20.5.170GENE3D:searchG3DSA_1.10.880.10/searchG3DSA_1.20.5.170PANTHER:searchPTHR11462/searchPTHR11462_SF8PFAM:searchPF00170PFAMB:searchPB003715/searchPB005413PRINTS:searchLEUZIPPRJUNPROSITE PATTERNS:searchPS00036, PROSITE PROFILES:searchPS50217, SMART:searchSM00338SUPERFAMILY:searchSSF47454/searchSSF57959UniProt:searchP05412
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..RKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQL
seq num:  ..267       277       287       297       307         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |  |    | ||      ||  ||^**            |  |  | 
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..|    |  |    | ||      **********************  |  | 
search RasMol script viewer Motif-ligand binding stats  BZIP_BASIC ..****************|       |  ||                  |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     |  |    |  |       *****                  |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****    ****       ****                   **** 

chain A : HUMAN IL-2 ARRE1 PROMOTER ELEMENT, PLUS STRAND
sec str:  ......................
sequence :  ..TTTGAAAATATGTGTAATAG
seq num:  ..4001      4011      

chain B : HUMAN IL-2 ARRE1 PROMOTER ELEMENT, MINUS STRAND
sec str:  ......................
sequence :  ..AACTATTACACATATTTTCA
seq num:  ..5001      5011      

   New search    1s9k:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors