triangle PDBeMotif: 1s9i  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.1.37
Classification transferase    | release date: Wed, Feb 4, 2004
Title x-ray structure of the human mitogen-activated protein kinase kinase 2 (mek2)in a complex with ligand and mgatp
Authors A.DELANEY, A.PAVLOVSKY, C.A.HASEMANN, C.WHITEHEAD, C.YAN, D.T.DUDLEY, H.CHEN, J.F.OHREN, J.SEBOLT-LEOPOLD, P.MCCONNELL
Method X-RAY DIFFRACTION (resolution: 3.20Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search ATP ATP binding statistics ATP   search 5EA 5EA binding statistics 5EA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
EAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFY
GAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFG
VSGQLIDSMANSFVGTRSYMAPERLQGTHYSVQSDIWSMGLSLVELAVGRYPIPPPDAKELEAIFGRPVVDGEEGEPHSI
SPRPRPPGRPVSGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTPDFQEFVNKCLIKNPAERADLKMLTNHTFIKRSEV
EEVDFAGWLCKTLRLNQPGTPTRTAVLEHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEINKINASE KINASE 2;
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24360/searchPTHR24360_SF15PFAM:searchPF00069PFAMB:searchPB004864PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchP36507
JMol viewer RasMol script viewer  5EA 1002B  ..                                                                                                                                                                    ..5EA ..                                                          ..                                                                                 
JMol viewer RasMol script viewer  5EA 1001A  ..                      *                  *                 *  *        **              *                                              *                ******  **  *..5EA ..                                                          ..                                                                                 
JMol viewer RasMol script viewer  ATP 535A  ..                  *****   *            * *                 |  |        ||              ** *   *  *                                    * * *  *         |*||||  ||  |..ATP ..                                                          ..                                                                                 
JMol viewer RasMol script viewer  MG 536A  ..                  |||||   |            | |                 |  |        ||              || |   |  |                                    | | |  |         |*||||  ||  |..MG ..                                                          ..                                                                                 
sec str:  ..........hhh.eeeeeeeee....eeeeeee.....eeeeeee.....hhhhhhhhhhhhhhh.........eeeeee....eeeeee....eehhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh........hhh.eee.....eee.....hhhhhhhh... .........hhhhhh....hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhh...........hhhhhhhhhhhh..........hhhhhhhhhhhh........hhhhhhhhhhhhhhhhh..hhhhhhhhhh......
sequence :  ..QKAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSM... ..VGTRSYMAPERLQGTHYSVQSDIWSMGLSLVELAVGRYPIPPPDAKELEAIFGRPVVD..RPAMAIFELLDYIVNEPPPKLPNGVFTPDFQEFVNKCLIKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPG
seq num:  ..60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220 ... ..228       238       248       258       268       278     ..313       323       333       343       353       363       373       383        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |      || ||     ||    |          |    || | |     |  ||   |  |  | | |||   |   || |                |  |       |   |             | |   | || || ||||||     ||||   |  |..PS00001..  | | |   | |||   |     |   |  |  | ||  |           | |   ..             | |       | |         |  | ||  | | | | ^***   |  |      |   |||||| |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..**      || ||     ||    |          |    || | |     |  ||   |  |  | | |||   |   || |                |  |       |   |             | |   | || || ||||||     ||||   |  |..PS00005..  | | |   | |||   |     |   |  |  | ||  |           | |   ..             | |       | |         |  | ||  | | | |  | |   |  |      |   ^**||| |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        || ||     ||    |          |    || | |     |  ||   |  |  | | |||   |   ^***                |  |       |   |             | |   | || || ||^***     ||||   |  |..PS00006..  | | |   | |||   |     |   ^***  | ||  |           | |   ..             | |       | |         |  | ||  | | | |  | |   ^***      |   |||||| |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        || ||     |^*****          ^*****| | |     |  ||   |  |  | | |||   ^***** |                |  |       |   |             | |   | || || || |||     ||||   |  |..PS00008..  | | |   | |^*****     |   |     | ||  |           | |   ..             | |       | |         |  | ||  | | | |  | |   |         |   |||||| |
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..        || ||     ************************ | |     |  ||   |  |  | | |||        | |                |  |       |   |             | |   | || || || |||     ||||   |  |..PS00107..  | | |   | |||         |   |     | ||  |           | |   ..             | |       | |         |  | ||  | | | |  | |   |         |   |||||| |
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..        || ||                              | |     |  ||   |  |  | | |||        | |                |  |       |   |             | ****^********| |||     ||||   |  |..PS00108..  | | |   | |||         |   |     | ||  |           | |   ..             | |       | |         |  | ||  | | | |  | |   |         |   |||||| |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        || ||                              | |     *****   |  |  | | |||        | |                |  |       |   |             | |   | || ||  | |||     ||||   |  |..alphabetamotif..  | | |   | |||         |   |     | ||  |           | |   ..             | |       | |         |  | ||  | | | |  | |   |         |   |||||| |
search RasMol script viewer Motif-ligand binding stats  asxturn ..        || ||                              | |     |  |    |  |  | | |||        | |                |  |       |   |             | |   | || ||  | |||     ||||   |  |..asxturn..  | | |   | |||         |   |     | ||  |           | |   ..             | |       | |         |  | ||  | *** |  | |   |         |   |||||| |
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        || ||                              | |     |  |    |  |  | | |||        | |                |  |       |   |             | |   | || ||  *****     ||||   |  |..betabulgeloop..  | | |   | |||         |   |     | ||  |           | |   ..             | |       | |         |  | ||  |     |  | |   |         |   |||||| |
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****|                              | |     ****    ****  | ****|        | |                |  |       |   |             | |   | ****|  ****|     ||||   ****..betaturn..  | | |   ****|         |   |     | ||  |           | |   ..             | |       | |         |  | ||  |     |  | |   |         |   |||||| |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         |  |                              ***                |  | | |||        ***                |  |       |   |             | |   | || ||    | |     ***|       ..gammaturn..  | | |     | |         |   |     | ||  |           | |   ..             | |       | |         |  | ||  |     |  | |   |         |   |||||***
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |                                                 |  | | |||                           |  |       |   |             | |   | || ||    ***      | |       ..nest..  | | |     ***         |   |     ***|  |           | |   ..             | |       ***         |  | ||  |     |  | |   |         |   |****   
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                                                 **** ****|                           ****       |   |             ***   | |****             ***       ..niche..  | ***                 |   |        ****           ***   ..             ***       ***         **********     **** |   |         |   | ***   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                   *****                                      |   |                   | |  |                        ..stmotif..  | | |                 |   |                             ..                                                       |   |         |   |       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                   | |                                        *****                   | |  |                        ..ststaple..  | | |                 *****                             ..                                                       *****         *****       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                   ***                                                                | |  |                        ..stturn..  | ***                                                   ..                                                                                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                      * *  *                        ..REP00000..  *                                                       ..                                                                                 

chain B : DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEINKINASE KINASE 2;
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24360/searchPTHR24360_SF15PFAM:searchPF00069PFAMB:searchPB004864PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchP36507
JMol viewer RasMol script viewer  5EA 1002B  ..                                          *                 *  *        *               *                                                                *****  *   *..5EA ..                                                    ..                                                                          
JMol viewer RasMol script viewer  ATP 537B  ..                   ** **   *            * *                 |  |        |               ** *   *  *                                      * ** *          *||||  |   |..ATP ..                                                    ..                                                                          
JMol viewer RasMol script viewer  MG 538B  ..                   || ||   |            | |                 |  |        |               || |   |  |                                      | |* |          *||||  |   |..MG ..                                                    ..                                                                          
sec str:  ...............eeeeeeeeee..eeeeeeee.....eeeeeeee......hhhhhhhhhhhhhhh.......eeeeeee..eeeeeee....eehhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh........hhh.eee.....eee.....hhhhhhh.... .......hhhhhhh....hhhhhhhhhhhhhhhhhh..........hhhhh......hhhhhhhhhhhh..........hhhhhhhhhhhh........hhhhhhhhhhhhhhhh...hhhhhhhhhhh.
sequence :  ..TQKAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSM... ..TRSYMAPERLQGTHYSVQSDIWSMGLSLVELAVGRYPIPPPDAKELEAIFGR..MAIFELLDYIVNEPPPKLPNGVFTPDFQEFVNKCLIKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRL
seq num:  ..59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       219  ... ..230       240       250       260       270         ..316       326       336       346       356       366       376       386 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |       |  |     ||    |         |||   ||      | |          || || | |||  ||   ||||                           |   |               |   | || || | || |     ||||       ..PS00001..| | ||  || |    |     |   |  |  | ||  |  | | || ||  ..         |  |     | | |         |  |  |  |     | ^***   |  |      |   ||||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**       |  |     ||    |         |||   ||      | |          || || | |||  ||   ||||                           |   |               |   | || || | || |     ||||       ..PS00005..| | ||  || |    |     |   |  |  | ||  |  | | || ||  ..         |  |     | | |         |  |  |  |     |  |     |  |      |   ^**|
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  |     ||    |         |||   ||      | |          || || | |||  ||   ^***                           |   |               |   | || || | ^***     ||||       ..PS00006..| | ||  || |    |     |   ^***  | ||  |  | | || ||  ..         |  |     | | |         |  |  |  |     |  |     ^***      |   || |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |  |     |^*****         |^*****|      | |          || || | |||  |^*****|                            |   |               |   | || || |  | |     ||||       ..PS00008..| | ||  || ^*****     |   |     | ||  |  | | || ||  ..         |  |     | | |         |  |  |  |     |  |     |  |      |   || |
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..          |  |     ************************      | |          || || | |||  ||   | |                            |   |               |   | || || |  | |     ||||       ..PS00107..| | ||  ||            |   |     | ||  |  | | || ||  ..         |  |     | | |         |  |  |  |     |  |     |  |      |   || |
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..          |  |                     | |           | |          || || | |||  ||   | |                            |   |               ****^********  | |     ||||       ..PS00108..| | ||  ||            |   |     | ||  |  | | || ||  ..         |  |     | | |         |  |  |  |     |  |     |  |      |   || |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |                     | |           | |          || || | |||  ||   | |                            |   |                   | || ||    | |     ||||       ..alphabetamotif..| | |*****            |   |     | ||  |  | | *****  ..         |  |     | | |         |  |  |  |     |  |     |  |      |   || |
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |                     | |           | |          || || | |||  ||   | |                            |   |                   | || ||    | |     ||||       ..asxturn..| | ||  |             |   |     | ||  |  *** || ||  ..         |  |     | | |         |  |  |  |     |  |     |  |      |   || |
search RasMol script viewer Motif-ligand binding stats  betabulge ..          |  |                     | |           | |          || || | |||  **   | |                            |   |                   | || ||    | |     ||||       ..betabulge..| | ||  |             |   |     | ||  |      || ||  ..         |  |     | | |         |  |  |  |     |  |     |  |      |   || |
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |                     | |           | |          ***** ****|       | |                            |   |                   | ****|    | |     ||||       ..betaturn..| | |****             |   |     | ||  |      ****|  ..         |  |     | | |         |  |  |  |     ****     |  |      |   || |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          |  |                     ***           ***           |  | | |||       ***                            |   |                   | || ||    | |     ***|       ..gammaturn..| | |                 |   |     | ||  |       |  |  ..         |  |     *** |         |  |  |  |     |  |     |  |      |   || |
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |                                                 |  | | |||                                      |   |                   | || ||    ***      | |       ..nest..| | |                 |   |     ***|  |       |  |  ..         |  |       | |         |  |  |  |     |  |     |  |      |   |***
search RasMol script viewer Motif-ligand binding stats  niche ..          ****                                                 **** ****|                                      |   |                   | |****             ***       ..niche..| ***                 |   |        ****       ****  ..         ****       ***         ****  ****     ****     ****      |   |   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                    *****                                      |   |                   | |  |                        ..stmotif..|                     |   |                         ..                                                                  |   |   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                    | |                                        *****                   | |  |                        ..ststaple..|                     *****                         ..                                                                  *****   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                    ***                                                                | |  |                        ..stturn..|                                                   ..                                                                          
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                       * *  *                        ..REP00000..*                                                   ..                                                                          

   New search    1s9i:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors