triangle PDBeMotif: 1qqw  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Download structure factors file
Classification oxidoreductase    | release date: Wed, Jun 9, 1999
Title crystal structure of human erythrocyte catalase
Authors C.WANG, D.J.ABRAHAM, F.N.MUSAYEV, M.K.SAFO, S.H.WU, T.P.KO
Method X-RAY DIFFRACTION (resolution: 2.75Å)
PDBe Citation   
Small molecules:    search HEM HEM binding statistics HEM
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAG
AFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPIL
FPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQ
GIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNR
NPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGG
APNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVK
NFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSGSHLAAREKANL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CATALASE
JMol viewer RasMol script viewer  HEM 600D  ..                                                         *                                                                                                                                                                                                                                                                                                                                                                                                                                                         
JMol viewer RasMol script viewer  HEM 600A  ..                                                         |          ****                                    *                  *              ***    *       *                                                      **                                                                                                                    *               *   *  **  **  *                                                                                                                                         
sec str:  ........hhhhhhhhhhh.....................eee.........hhhhhhhhhhhhhhh........eeeeeeeeeee.................eeeeeeeeeee..............eeeeeee......eeeeeee.......hhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh............eeeeeeeeeee..eeeeeeeeeeeeee.....hhhhhhhhhhhh.hhhhhhhhhhhhhhh.eeeeeeeeee.............................eeeee.....hhhhhhh.................hhhhhhhhhhhhhhhhhhhh.......................................................eeeeeeee.......hhhhhhhhhhh...hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.
sequence :  ..SRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNA
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                | |        |||   | ||    |  |     | | |   ||||| |      | |  |          |  || |  |||| ||         | || || |||||                     | |    | |      || |    | | | |    | |||  ||   ||  | ||    |         | |  | | |         | |   ^*** |  | |  |  |          | |           | |  |||  |  | ||                 ||   |   ||  |  | ||||  |  | |     |   |  |||||    |  ||  ||  |   | |        ||||    |    | |    || ||             |  | ^***           |  ||    |  ||  ||  ||   | ^***  |   |           
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                | |        |||   | ||    |  |     | | |   ||||| |      | |  |          |  || |  |||| ||         | || || |^**|                     | |    | |      |^**    | | | |    | ^**  ||   ||  ^**|    |         ^**  | | |         | |     |  |  | |  |  |          ^**           | |  |||  |  | ||                 ||   |   ||  |  | ||||  |  | |     |   |  ^**||    |  ||  ||  |   | |        ||||    |    | |    || ||             |  |                |  ||    |  ||  ||  ||   |   |   |   |           
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                | |        |||   | ||    |  |     | | |   ||||| |      | |  |          |  || |  |||| ||         | || || |^***                     | |    | |      |  |    | | | |    |  ||  ||   ||  | ||    |              | | |         | |     ^***  | ^***  |          | |           | |  |||  |  | ||                 ||   |   ||  |  | ||||  |  | |     |   |  || ||    |  ||  ||  |   | |        ||||    |    | |    |^***             ^***                |  ||    |  ||  ||  ||   |   |   |   |           
search RasMol script viewer Motif-ligand binding stats  PS00007 ..                | |        |||   | ||    |  |     | | |   ||||| |      | |  |          |  || |  |||| ||         | || || | |                       | |    | |      |  |    | | | |    |  ||  ||   ||  | ||    |              | | |         | |           ********^          | |           | |  |||  |  | ||                 ||   |   ||  |  | ||||  |  | |     |   |  || ||    |  ||  ||  |   | |        ||||    |    | |    |  |                                  |  ||    |  ||  ||  ||   |   |   |   |           
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                | |        |^***** ||    |  |     | | |   ||||| |      | |  |          |  || |  |||| ||         | || ^*****                       | |    | |      |  |    | | | |    |  ||  ||   ||  | |^*****              | | |         | |                              | |           | |  |||  |  | ||                 ||   |   ||  |  | ||||  |  | |     |   |  || ||    |  ||  ||  |   | |        |||^*****    | |    |  |                                  |  ||    |  ||  ||  ||   |   |   |   |           
search RasMol script viewer Motif-ligand binding stats  PS00009 ..                | |        | |   | ||    |  |     | | |   ||||| |      | |  |          |  || |  |||^***         | ||  | | |                       | |    | |      |  |    | | | |    |  ||  ||   ||  | |                    | | |         | |                              | |           | |  |||  |  | ||                 ||   |   ||  |  | ||||  |  | |     |   |  || ||    |  ||  ||  |   | |        ||||         | |    |  |                                  |  ||    |  ||  ||  ||   |   |   |   |           
search RasMol script viewer Motif-ligand binding stats  PS00437 ..                | |        | |   | ||    |  |     | | |   ||||| |      | |  |          |  || |  |||  |          | ||  | | |                       | |    | |      |  |    | | | |    |  ||  ||   ||  | |                    | | |         | |                              | |           | |  |||  |  | ||                 ||   |   ||  |  | ||||  |  | |     ****^**** ||    |  ||  ||  |   | |        ||||         | |    |  |                                  |  ||    |  ||  ||  ||   |   |   |   |           
search RasMol script viewer Motif-ligand binding stats  PS00438 ..                | |        | |   | ||    |  |     | | |   ||***********^*****          |  || |  |||  |          | ||  | | |                       | |    | |      |  |    | | | |    |  ||  ||   ||  | |                    | | |         | |                              | |           | |  |||  |  | ||                 ||   |   ||  |  | ||||  |  | |            |  ||    |  ||  ||  |   | |        ||||         | |    |  |                                  |  ||    |  ||  ||  ||   |   |   |   |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                | |        | |   | ||    |  |     | | |   || || |      | |             ***** *****|  |          | ||  | | |                       | |    | |      |  |    | | | |    *****  ||   ||  | |                    | | |         | |                              | |           | *****|  |  | ||                 ||   |   ||  |  | ||||  |  | |            *****    |  ||  ||  |   | |        ||||         | |    |  |                                  *****    *****  |*****   |   |   |   |           
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                | |        | |   | ||    |  |     | | |   || || |      | |             |  || |  | |  |          | ||  | | |                       | |    | |      |  |    | | | |    |  ||  ||   ||  | |                    | | |         | |                              | |           | |  | |  |  | ||                 ||   *****|  |  | ||||  |  | |            |  |     |  ||  ||  |   | |        ||||         | |    |  |                                  |  |     |  ||  ||  |    |   |   |   |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..                | |        | |   ***|    |  |     *** |   || || |      | |             |  || |  | |  |          | ||  | | |                       | |    ***      |  |    | | ***    |  ||  ||   ||  | |                    *** |         | |                              | |           | |  | |  |  ***|                 ||        |  |  | ||||  |  | |            |  |     |  ||  ||  |   ***        ||||         | |    |  |                                  |  |     |  ||  ||  |    |   |   |   |           
search RasMol script viewer Motif-ligand binding stats  betabulge ..                | |        | |   |  |    |  |     |   |   || || |      | |             |  || |  | |  |          | ||  | | |                       | |             |  |    | |        |  ||  ||   ||  | |                      | |         | |                              | |           | |  | |  |  |  |                 **        |  |  | ||||  |  | |            |  |     |  ||  ||  |              ||||         | |    |  |                                  |  |     |  ||  ||  |    |   |   |   |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..                | |        | |   |  |    |  |     |   |   ***** |      | |             ****| **** ****          | ||  | | |                       | |             ****    | |        ********|   |**** |                      | |         | |                              | |           | **** |  |  |  |                           |  |  ****|****  | |            ****     |  ||  ||  |              ****         | |    |  |                                  ****     ****|  |****    |   |   |   |           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                | |        | |   |  |    |  |     |   |       | |      | |                 | |    |  |          | ||  | ***                       | |                     | |                |   |   | |                      | |         | |                              | |           | |  | |  |  |  |                           |  |    ***|  |  | |                     |  ||  ||  |              ||||         | |    |  |                                               |  |        |   |   |   |           
search RasMol script viewer Motif-ligand binding stats  nest ..                | |        ***   |  |    |  |     |   |       | |      ***                 | |    |  |          | ||  |                           | |                     ***                |   |   | |                      ***         | |                              ***           | |  | |  |  |  |                           |  |       |  |  | |                     |  ||  ||  |              ***|         ***    |  |                                               |  |        |   |   |   |           
search RasMol script viewer Motif-ligand binding stats  niche ..                ***              ****    ****     |   |       ***                          ***    ****          *******                           | |                                        |   |   | |                                  | |                                            | |  ***  *******                           ****       ****  ***                     ************               ***                ****                                               ****        |   |   |   |           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                  *****                                                                                           | |                                        *****   | |                                  | |                                            | |                                                                                                                                                                                               *****   *****           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                  ***                                                ***                                  ***                                            ***                                                                                                                                                                                                                       

chain B : CATALASE
JMol viewer RasMol script viewer  HEM 600C  ..                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  HEM 600B  ..                                                                    ****                                    *                  *              ***    *    *  *                                                      **                                                                                                                    *               *   *  **  **  *                                                                                                                                          
sec str:  ........hhhhhhhhhhh.....................eee.........hhhhhhhhhhhhhhh........eeeeeeeeeee.................eeeeeeeeeee..............eeeeeee......eeeeeee.......hhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh............eeeeeeeeeee..eeeeeeeeeeeeee.....hhhhhhhhhhhh.hhhhhhhhhhhhhhh.eeeeeeeeee.............................eeeee.....hhhhhhh.................hhhhhhhhhhhhhhhhhhhh.......................................................eeeeeeee.......hhhhhhhhhhh...hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..
sequence :  ..SRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAE
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       
search RasMol script viewer Motif-ligand binding stats  PS00001 ..  |  ||         | |      | |||   | ||    |  |     | | |   ||||| |      | |  |           |  | || |||| ||         | || || |||||         | |         | |    |||||     | | | || | |  ||  | |||  |        | ||    |  |      | |  | |||         | |   ^***||  | |  |  |      |   | |           | | ||||  | |||||                 ||   |   ||  |  | ||||  |  | |     |   |  |||      |  || |||  |   | |        ||||    |           || ||             |  | ^***||   |  |           |  ||  |          ^***  |   |            
search RasMol script viewer Motif-ligand binding stats  PS00005 ..  |  ||         | |      | |||   | ||    |  |     | | |   ||||| |      | |  |           |  | || |||| ||         | || || |^**|         | |         | |    |||||     ^** | || | |  ||  | ^**  |        ^**|    |  |      ^**  | |||         | |     | ||  | |  |  |      |   ^**           | | ||||  | |||||                 ||   |   ||  |  | ||||  |  | |     |   |  ^**      |  || |||  |   | |        ||||    |           || ||             |  |  |  ||   |  |           |  ||  |                |   |            
search RasMol script viewer Motif-ligand binding stats  PS00006 ..  |  ||         | |      | |||   | ||    |  |     | | |   ||||| |      | |  |           |  | || |||| ||         | || || |^***         | |         | |    |||||         | || | |  ||  |  ||  |        | ||    |  |           | |||         | |     ^***  | ^***  |      |   | |           | | ||||  | |||||                 ||   |   ||  |  | ||||  |  | |     |   |   |       |  || |||  |   | |        ||||    |           |^***             ^***  |  ||   |  |           |  ||  |                |   |            
search RasMol script viewer Motif-ligand binding stats  PS00007 ..  |  ||         | |      | |||   | ||    |  |     | | |   ||||| |      | |  |           |  | || |||| ||         | || || | |           | |         | |    |||||         | || | |  ||  |  ||  |        | ||    |  |           | |||         | |     | |   ********^      |   | |           | | ||||  | |||||                 ||   |   ||  |  | ||||  |  | |     |   |   |       |  || |||  |   | |        ||||    |           |  |                    |  ||   |  |           |  ||  |                |   |            
search RasMol script viewer Motif-ligand binding stats  PS00008 ..  |  ||         | |      | |^***** ||    |  |     | | |   ||||| |      | |  |           |  | || |||| ||         | || ^*****           | |         | |    |||||         | || | |  ||  |  ||  |        | |^*****  |           | |||         | |     | |                  |   | |           | | ||||  | |||||                 ||   |   ||  |  | ||||  |  | |     |   |   |       |  || |||  |   | |        |||^*****           |  |                    |  ||   |  |           |  ||  |                |   |            
search RasMol script viewer Motif-ligand binding stats  PS00009 ..  |  ||         | |      | | |   | ||    |  |     | | |   ||||| |      | |  |           |  | || |||^***         | ||  | | |           | |         | |    |||||         | || | |  ||  |  ||  |        | |     |  |           | |||         | |     | |                  |   | |           | | ||||  | |||||                 ||   |   ||  |  | ||||  |  | |     |   |   |       |  || |||  |   | |        ||||                |  |                    |  ||   |  |           |  ||  |                |   |            
search RasMol script viewer Motif-ligand binding stats  PS00437 ..  |  ||         | |      | | |   | ||    |  |     | | |   ||||| |      | |  |           |  | || |||  |          | ||  | | |           | |         | |    |||||         | || | |  ||  |  ||  |        | |     |  |           | |||         | |     | |                  |   | |           | | ||||  | |||||                 ||   |   ||  |  | ||||  |  | |     ****^****       |  || |||  |   | |        ||||                |  |                    |  ||   |  |           |  ||  |                |   |            
search RasMol script viewer Motif-ligand binding stats  PS00438 ..  |  ||         | |      | | |   | ||    |  |     | | |   ||***********^*****           |  | || |||  |          | ||  | | |           | |         | |    |||||         | || | |  ||  |  ||  |        | |     |  |           | |||         | |     | |                  |   | |           | | ||||  | |||||                 ||   |   ||  |  | ||||  |  | |                     |  || |||  |   | |        ||||                |  |                    |  ||   |  |           |  ||  |                |   |            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  *****         | |      | | |   | ||    |  |     | | |   || || |      | |              |  | || |||  |          | ||  | | |           | |         | |    |||||         | || | *****  *****  |        | |     |  |           | |||         | |     | |                  |   | |           | *****|  | |||||                 ||   |   ||  |  | ||||  |  | |                     |  *****|  |   | |        ||||                |  |                    *****   |  |           *****  |                |   |            
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  |          | |      | | |   | ||    |  |     | | |   || || |      | |              |  | || |||  |          | ||  | | |           | |         | |    *****         | || | |  |   |  ||  |        | |     |  |           | |||         | |     | |                  |   | |           | | || |  *****||                 ||   *****|  |  | ||||  |  | |                     |  || |||  |   | |        ||||                |  |                    |  |    |  |           |  ||  |                |   |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |          | |      | | |   ***|    |  |     *** |   || || |      | |              |  | || |||  |          | ||  | | |           | |         | |    ***||         ***| | |  |   |  ||  |        | |     |  |           | |||         | |     | |                  |   | |           | | || |  ******|                 ||        |  |  | ||||  |  | |                     |  || |||  |   ***        ||||                |  |                    |  |    |  |           |  ||  |                |   |            
search RasMol script viewer Motif-ligand binding stats  betabulge ..  |  |          | |      | | |   |  |    |  |     |   |   || || |      | |              |  | || |||  |          | ||  | | |           | |         | |    || ||            | | |  |   |  ||  |        | |     |  |           | |||         | |     | |                  |   | |           | | || |  |  |  |                 **        |  |  | ||||  |  | |                     |  || |||  |   | |        ||||                |  |                    |  |    |  |           |  ||  |                |   |            
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  |  |          | |      | | |   |  |    |  |     |   |   || || |      | |              |  | || |||  |          | ||  | | |           | |         | |    || ||            | | |  |   |  ||  |        | |     |  |           *****         | |     | |                  |   | |           | | || |  |  |  |                           |  |  | ||||  |  | |                     |  || |||  |   | |        ||||                |  |                    |  |    |  |           |  ||  |                |   |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****          | |      | | |   |  |    |  |     |   |   ***** |      | |              |  | *********          | |**** | |           | |         | |    *****            | | ****   ********        | |     |  |           ****|         | |     | |                  |   | |           | **** |  ****  |                           ****  ****|****  | |                     |  ****|****   | |        ****                |  |                    ****    |  |           ****|  |                |   |            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                | |      | | |   |  |    |  |     |   |       | |      | |              |  | |    |  |          | ||  | ***           | |         | |                     | |                        | |     |  |             | |         | |     | |                  |   | |           | | |  |  |  |  |                           |  |    ***|  |  | |                     |  ||  |       | |        ||||                |  |                            |  |               |  |                |   |            
search RasMol script viewer Motif-ligand binding stats  nest ..                | |      | ***   |  |    |  |     |   |       | |      ***              |  | |    |  |          | ||  |               | |         | |                     ***                        | |     |  |             ***         | |     | |                  |   ***           | | |  |  |  |  |                           |  |       |  |  | |                     |  ||  |       | |        ***|                |  |                            |  |               |  |                |   |            
search RasMol script viewer Motif-ligand binding stats  niche ..                ***      | |     ****    ****     |   |       ***                       ******    ****          *******               | |         | |                                                | |     ****                         | |     | |                  |   |             | | ****  *******                           ****       ****  ***                     ********       ***         ***                ****                            ****               ****                |   |            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         | |                      *****                                    | |                                        | |         | |                                                | |                                  | |     | |                  *****             | |                                                          | |                                                                                                                                          *****            
search RasMol script viewer Motif-ligand binding stats  stturn ..                         ***                                                               ***                                        ***         ***                                                ***                                  ***     ***                                    ***                                                          ***                                                                                                                                                           

chain C : CATALASE
JMol viewer RasMol script viewer  HEM 600C  ..                                                                    ****                                                       **             ***    *    *  *                                                      **                                                                                                                    *               *   *  **  **  *                                                                                                                                         
JMol viewer RasMol script viewer  HEM 600B  ..                                                         *          ||||                                                       ||             |||    |    |  |                                                      ||                                                                                                                    |               |   |  ||  ||  |                                                                                                                                         
sec str:  ........hhhhhhhhhhh.....................eee.........hhhhhhhhhhhhhhh........eeeeeeeeeee.................eeeeeeeeeee..............eeeeeee......eeeeeee.......hhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh............eeeeeeeeeee..eeeeeeeeeeeeee.....hhhhhhhhhhhh.hhhhhhhhhhhhhhh.eeeeeeeeee.............................eeeee.....hhhhhhh.................hhhhhhhhhhhhhhhhhhhh.......................................................eeeeeeee.......hhhhhhhhhhh...hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.
sequence :  ..SRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNA
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                | |      | |||   | ||    |  |     |   |    || | |      | |  |          || || |    || ||         | || || |||||         | |         | |    |||||     | |    | |        | |||  ||   |   | ||    |  |      | |  | | |         | |   ^***||  | |  |  |      |   | |           | | ||||  | |||||                 ||        |  |  |  | |  |  | |  |  ||  |  |||      |  || |||  |   | |        ||||    |    | |    || ||             |  | ^***                    |  ||  |          ^***  |   |           
search RasMol script viewer Motif-ligand binding stats  PS00005 ..                | |      | |||   | ||    |  |     |   |    || | |      | |  |          || || |    || ||         | || || |^**|         | |         | |    |||||     ^**    | |        | ^**  ||   |   ^**|    |  |      ^**  | | |         | |     | ||  | |  |  |      |   ^**           | | ||||  | |||||                 ||        |  |  |  | |  |  | |  |  ||  |  ^**      |  || |||  |   | |        ||||    |    | |    || ||             |  |                         |  ||  |                |   |           
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                | |      | |||   | ||    |  |     |   |    || | |      | |  |          || || |    || ||         | || || |^***         | |         | |    |||||            | |        |  ||  ||   |      |    |  |           | | |         | |     ^***  | ^***  |      |   | |           | | ||||  | |||||                 ||        |  |  |  | |  |  | |  |  ||  |   |       |  || |||  |   | |        ||||    |    | |    |^***             ^***                         |  ||  |                |   |           
search RasMol script viewer Motif-ligand binding stats  PS00007 ..                | |      | |||   | ||    |  |     |   |    || | |      | |  |          || || |    || ||         | || || | |           | |         | |    |||||            | |        |  ||  ||   |      |    |  |           | | |         | |     | |   ********^      |   | |           | | ||||  | |||||                 ||        |  |  |  | |  |  | |  |  ||  |   |       |  || |||  |   | |        ||||    |    | |    |  |                                           |  ||  |                |   |           
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                | |      | |^***** ||    |  |     |   |    || | |      | |  |          || || |    || ||         | || ^*****           | |         | |    |||||            | |        |  ||  ||   |      ^*****  |           | | |         | |     | |                  |   | |           | | ||||  | |||||                 ||        |  |  |  | |  |  | |  |  ||  |   |       |  || |||  |   | |        |||^*****    | |    |  |                                           |  ||  |                |   |           
search RasMol script viewer Motif-ligand binding stats  PS00009 ..                | |      | | |   | ||    |  |     |   |    || | |      | |  |          || || |    |^***         | ||  | | |           | |         | |    |||||            | |        |  ||  ||   |           |  |           | | |         | |     | |                  |   | |           | | ||||  | |||||                 ||        |  |  |  | |  |  | |  |  ||  |   |       |  || |||  |   | |        ||||         | |    |  |                                           |  ||  |                |   |           
search RasMol script viewer Motif-ligand binding stats  PS00437 ..                | |      | | |   | ||    |  |     |   |    || | |      | |  |          || || |    |  |          | ||  | | |           | |         | |    |||||            | |        |  ||  ||   |           |  |           | | |         | |     | |                  |   | |           | | ||||  | |||||                 ||        |  |  |  | |  |  | |  |  ****^****       |  || |||  |   | |        ||||         | |    |  |                                           |  ||  |                |   |           
search RasMol script viewer Motif-ligand binding stats  PS00438 ..                | |      | | |   | ||    |  |     |   |    |***********^*****          || || |    |  |          | ||  | | |           | |         | |    |||||            | |        |  ||  ||   |           |  |           | | |         | |     | |                  |   | |           | | ||||  | |||||                 ||        |  |  |  | |  |  | |  |  ||              |  || |||  |   | |        ||||         | |    |  |                                           |  ||  |                |   |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                | |      | | |   | ||    |  |     |   |    |  | |      | |             ***** |    |  |          | ||  | | |           | |         | |    |||||            | |        *****  ||   |           |  |           | | |         | |     | |                  |   | |           | *****|  | |||||                 ||        |  |  |  | |  |  | |  *****              |  *****|  |   | |        ||||         | |    |  |                                           |  ||  |                |   |           
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                | |      | | |   | ||    |  |     |   |    |  | |      | |             || || |    |  |          | ||  | | |           | |         | |    *****            | |        |  ||  ||   |           |  |           | | |         | |     | |                  |   | |           | | || |  *****||                 ||        |  |  |  | |  |  | |  |  |               |  || |||  |   | |        ||||         | |    |  |                                           |  ||  |                |   |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..                | |      | | |   ***|    |  |     |   |    |  | |      | |             || || |    |  |          | ||  | | |           | |         | |    ***||            | |        |  ||  ||   |           |  |           *** |         | |     | |                  |   | |           | | || |  ******|                 ||        |  |  |  | |  |  | |  |  |               |  || |||  |   | |        ||||         | |    |  |                                           |  ||  |                |   |           
search RasMol script viewer Motif-ligand binding stats  betabulge ..                | |      | | |   |  |    |  |     |   |    |  | |      | |             || || |    |  |          | ||  | | |           | |         | |    || ||            | |        |  ||  ||   |           |  |             | |         | |     | |                  |   | |           | | || |  |  |  |                 **        |  |  |  | |  |  | |  |  |               |  || |||  |   | |        ||||         | |    |  |                                           |  ||  |                |   |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..                | |      | | |   |  |    ****     |   |    **** |      | |             ****| |    ****          | |**** | |           | |         | |    *****            | |        ********|   |           |  |             | |         | |     | |                  |   | |           | **** |  ****  |                           |  |  |  | ****  | |  ****               |  ****|****   | |        ****         | |    |  |                                           ****|  |                |   |           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                | |      | | |   |  |    |  |     |   |       | |      | |              |  | |    |  |          | ||  | ***           | |         | |                     | |                |   |           |  |             | |         | |     | |                  |   | |           | | |  |  |  |  |                           |  |  |  | |  |  | |                     |  ||  ||  |   | |        ||||         | |    |  |                                               |  |                |   |           
search RasMol script viewer Motif-ligand binding stats  nest ..                | |      | ***   |  |    |  |     |   |       | |      ***              |  | |    |  |          | ||  |               | |         | |                     ***                |   |           |  |             ***         | |     | |                  |   ***           | | |  |  |  |  |                           |  |  |  | |  |  | |                     |  ||  ||  |   | |        ***|         ***    |  |                                               |  |                |   |           
search RasMol script viewer Motif-ligand binding stats  niche ..                ***      | |     ****    ****     |   |       ***      ***              ******    ****          *******               | |         | |                                        |   |           ****                         | |     | |                  |   |             | | ****  *******                           ****  **** ****  ***                     ************   ***         ***                ****                                               ****                |   |           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         | |                      *****                                    | |                                        | |         | |                                        *****                                        | |     | |                  *****             | |                                                                                                                                                                                                       *****           
search RasMol script viewer Motif-ligand binding stats  stturn ..                         ***                                                               ***                                        ***         ***                                                                                     ***     ***                                    ***                                                                                                                                                                                                                       

chain D : CATALASE
JMol viewer RasMol script viewer  HEM 600D  ..                                                                    ****                                    *                  *              ***    *       *                                                                                                                                                                            *               *   *   *  **  *                                                                                                                                         
JMol viewer RasMol script viewer  HEM 600A  ..                                                         *          ||||                                    |                  |              |||    |       |                                                                                                                                                                            |               |   |   |  ||  |                                                                                                                                         
sec str:  ........hhhhhhhhhhh.....................eee.........hhhhhhhhhhhhhhh........eeeeeeeeeee.................eeeeeeeeeee..............eeeeeee......eeeeeee.......hhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh............eeeeeeeeeee..eeeeeeeeeeeeee.....hhhhhhhhhhhh.hhhhhhhhhhhhhhh.eeeeeeeeee.............................eeeee.....hhhhhhh.................hhhhhhhhhhhhhhhhhhhh.......................................................eeeeeeeee......hhhhhhhhhhh...hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.
sequence :  ..SRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNA
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494      
search RasMol script viewer Motif-ligand binding stats  PS00001 ..  |  ||     |  || |      | |||   | ||    |  |     | |      || | |      | |  |              | |    || ||         | || || |||||         | |         | |     |  |    || | | || | | |    | |||  |        |||||   |  |      | |  | | |         | |   ^*** |  | |  |  |      |   | |           | | ||||  | || ||                           |  |  | ||||  |  | |     |   |  |||      |  || |||  |   | |        ||||    |    | |    || ||             |  | ^***                    |  ||  |          ^***|||  || ||        
search RasMol script viewer Motif-ligand binding stats  PS00005 ..  |  ||     |  || |      | |||   | ||    |  |     | |      || | |      | |  |              | |    || ||         | || || |^**|         | |         | |     |  |    |^** | || | | |    | ^**  |        ^**||   |  |      ^**  | | |         | |     |  |  | |  |  |      |   ^**           | | ||||  | || ||                           |  |  | ||||  |  | |     |   |  ^**      |  || |||  |   | |        ||||    |    | |    || ||             |  |                         |  ||  |           |  |||  || ||        
search RasMol script viewer Motif-ligand binding stats  PS00006 ..  |  ||     |  || |      | |||   | ||    |  |     | |      || | |      | |  |              | |    || ||         | || || |^***         | |         | |     |  |    |  | | || | | |    |  ||  |        || ||   |  |           | | |         | |     ^***  | ^***  |      |   | |           | | ||||  | || ||                           |  |  | ||||  |  | |     |   |   |       |  || |||  |   | |        ||||    |    | |    |^***             ^***                         |  ||  |           |  |||  || ||        
search RasMol script viewer Motif-ligand binding stats  PS00007 ..  |  ||     |  || |      | |||   | ||    |  |     | |      || | |      | |  |              | |    || ||         | || || | |           | |         | |     |  |    |  | | || | | |    |  ||  |        || ||   |  |           | | |         | |           ********^      |   | |           | | ||||  | || ||                           |  |  | ||||  |  | |     |   |   |       |  || |||  |   | |        ||||    |    | |    |  |                                           |  ||  |           |  |||  || ||        
search RasMol script viewer Motif-ligand binding stats  PS00008 ..  |  ||     |  || |      | |^***** ||    |  |     | |      || | |      | |  |              | |    || ||         | || ^*****           | |         | |     |  |    |  | | || | | |    |  ||  |        || ^*****  |           | | |         | |                          |   | |           | | ||||  | || ||                           |  |  | ||||  |  | |     |   |   |       |  || |||  |   | |        |||^*****    | |    |  |                                           |  ||  |           |  |||  || ||        
search RasMol script viewer Motif-ligand binding stats  PS00009 ..  |  ||     |  || |      | | |   | ||    |  |     | |      || | |      | |  |              | |    |^***         | ||  | | |           | |         | |     |  |    |  | | || | | |    |  ||  |        || ||   |  |           | | |         | |                          |   | |           | | ||||  | || ||                           |  |  | ||||  |  | |     |   |   |       |  || |||  |   | |        ||||         | |    |  |                                           |  ||  |           |  |||  || ||        
search RasMol script viewer Motif-ligand binding stats  PS00437 ..  |  ||     |  || |      | | |   | ||    |  |     | |      || | |      | |  |              | |    |  |          | ||  | | |           | |         | |     |  |    |  | | || | | |    |  ||  |        || ||   |  |           | | |         | |                          |   | |           | | ||||  | || ||                           |  |  | ||||  |  | |     ****^****       |  || |||  |   | |        ||||         | |    |  |                                           |  ||  |           |  |||  || ||        
search RasMol script viewer Motif-ligand binding stats  PS00438 ..  |  ||     |  || |      | | |   | ||    |  |     | |      |***********^*****              | |    |  |          | ||  | | |           | |         | |     |  |    |  | | || | | |    |  ||  |        || ||   |  |           | | |         | |                          |   | |           | | ||||  | || ||                           |  |  | ||||  |  | |                     |  || |||  |   | |        ||||         | |    |  |                                           |  ||  |           |  |||  || ||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  *****     |  || |      | | |   | ||    |  |     | |      |  | |      | |                 | |    |  |          | ||  | | |           | |         | |     |  |    |  | | || | | |    |  ||  |        || ||   |  |           | | |         | |                          |   | |           | *****|  | || ||                           |  |  | ||||  |  | |                     |  || |||  |   | |        ||||         | |    |  |                                           |  ||  |           *****|  *****        
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |      |  || |      | | |   ***|    |  |     ***      |  | |      | |                 | |    |  |          | ||  | | |           | |         | |     |  |    |  | ***| | ***    |  ||  |        || ||   |  |           *** |         | |                          |   | |           | | || |  ******|                           |  |  | ||||  |  | |                     |  || |||  |   ***        ||||         | |    |  |                                           |  ||  |           |  | |  || |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****      ****| |      | | |   |  |    |  |              **** |      | |                 | |    ****          | |**** | |           | |         | |     ****    ****    | |        ********        ****|   |  |             | |         | |                          |   | |           | **** |  |  |  |                           |  |  ****|****  | |                     |  ****||  |   | |        ****         | |    |  |                                           ****|  |           **** |  ****         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                | |      | | |   |  |    |  |                 | |      | |                 | |    |  |          | ||  | ***           | |         | |                     | |                         |  |   |  |             | |         | |                          |   | |           | | |  |  |  |  |                           |  |    ***|  |  | |                     |  ||  ||  |   | |        ||||         | |    |  |                                               |  |                |   |           
search RasMol script viewer Motif-ligand binding stats  nest ..                | |      | ***   |  |    |  |                 | |      ***                 | |    |  |          | ||  |               | |         | |                     ***                         |  |   |  |             ***         | |                          |   ***           | | |  |  |  |  |                           |  |       |  |  | |                     |  ||  ||  |   | |        ***|         ***    |  |                                               |  |                |   |           
search RasMol script viewer Motif-ligand binding stats  niche ..                ***      | |     ****    ****                 ***                          ***    ****          *******               | |         | |                     | |                         ****   ****                         | |                          |   |             | | ****  *******                           ****       ****  ***                     ************   ***         ***                ****                                               ****                |   |           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         | |                                                               | |                                        | |         | |                     | |                                                             | |                          *****             | |                                                                                                                                                                                                       *****           
search RasMol script viewer Motif-ligand binding stats  stturn ..                         ***                                                               ***                                        ***         ***                     ***                                                             ***                                            ***                                                                                                                                                                                                                       

   New search    1qqw:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML  |  Structure factors