triangle PDBeMotif: 1qpj  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.1.112
Classification transferase    | release date: Tue, May 25, 1999
Title crystal structure of the lymphocyte-specific kinase lck in complex with staurosporine.
Authors D.R.STOVER, J.L.KIM, L.M.TOLEDO, P.E.ROSE, X.ZHU
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search STU STU binding statistics STU   search SO4 SO4 binding statistics SO4
Modified residues:  search PTR PTR binding statistics PTR
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
KPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLYAVVTQE
PIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIE
DNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELY
QLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQPQP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : LCK TYROSINE KINASE
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF39PFAM:searchPF07714PRINTS:searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109, PROSITE PROFILES:searchPS50011, SMART:searchSM00219SUPERFAMILY:searchSSF55550/searchSSF56112UniProt:searchP06239
JMol viewer RasMol script viewer  STU 902A  ..               **      *           * *                                          ****  **                                            *  *          *                                                                                                                       
JMol viewer RasMol script viewer  SO4 901A  ..               ||      |           | |                        **                ||||  ||                                            |  |     * *  |                                                                                                                       
sec str:  .......hhh.eeeeeeeeee..eeeeeeee...eeeeeee......hhhhhhhhhhhhhhh.......eeeee.....eeeee.....hhhhhh.hhhhhh.hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee...................hhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhh...hhhhh.hhhhhhhhhhhhhhhh
sequence :  ..DEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTAT
seq num:  ..236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |  | ||| || |                     || | |||         | || | |  |                    ^*** ||  |  |  | |          || |||| || | |||| |  | |  | | |  ||| || | |  || || |   |  |  |   | | | ||||  || ||||||| |   |  ||| ||||||||||    |  |  |  || || ||  |  |     | |||| |||||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  | ^** || |                     |^** |||         | || | |  |                      |  ||  |  |  | |          || |||| || | |||| |  | |  | ^**  ||| || | |  |^**| |   |  |  |   | | ^**|||  || ||||||| |   |  ||| ||||||||||    |  |  |  || || ||  |  |     | |||| |||||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |  |  |  || |                     |  | |||         | || | |  |                      ^***|  |  |  | |          || |||| || | |||| |  | |  | |    ||| || | |  |^*** |   |  ^***   | | |  |||  || ||||||| |   |  |^***|||||||||    |  |  |  || || ||  |  |     | ^*** ||^**
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|  |  |  |  || |                     |  | |||         | || | |  |                          |  |  |  | |          || |||| || | |||| |  | |  | |    ||| |*******^  |  |   |  |      | | |  |||  || ||||||| |   |  | |  |||||||||    |  |  |  || || ||  |  |     |  ||| |||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |  |  |  || |                     |  | |||         | || | |  |                          |  |  ^*****          || |||| || | |||| |  | |  | |    ||| |  | |     |  |   |  |      | | |  |||  |^*****||| |   |  | |  |||||||||    |  |  |  || || ||  |  |     |  ||| |||||
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..|  |  |  |  || ***********************  | |||         | || | |  |                          |  |  |  |            || |||| || | |||| |  | |  | |    ||| |  | |     |  |   |  |      | | |  |||  || ||| ||| |   |  | |  |||||||||    |  |  |  || || ||  |  |     |  ||| |||||
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_TYR ..|  |  |  |  ||                          | |||         | || | |  |                          |  |  |  |            || |||| || ****^********  | |    ||| |  | |     |  |   |  |      | | |  |||  || ||| ||| |   |  | |  |||||||||    |  |  |  || || ||  |  |     |  ||| |||||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |  |  |  ||                          | |||         | || | |  |                          |  |  |  |            *****|| || | |||| |  |    | |    ||| |  | |     |  |   |  |      | | *****************| |   |  | **********||    |  |  ***** || ||  |  |     **********||
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |  |  |  ||                          | |||         | || | |  |                          |  |  |  |            || |||| || | |||| |  |    | |    *** |  | |     |  |   |  |      | | |  | |  || ||| | | |   |  | |  |||||||||    |  |  |  |  || ||  |  |     |  ||| || ||
search RasMol script viewer Motif-ligand binding stats  betabulge ..|  |  |  |  **                          | |||         | || | |  |                          |  |  |  |            || |||| || | |||| |  |    | |    ||| |  | |     |  |   |  |      | | |  | |  || ||| | | |   |  | |  |||||||||    |  |  |  |  || ||  |  |     |  ||| || ||
search RasMol script viewer Motif-ligand binding stats  betaturn ..****  |  |                              ****|         ****** |  |                          ****  |  |            ********** | |||| |  |    | |    |****  | |     |  |   ****      | | **** *********** | |   **** ***********|    |  |  ****  ****|  |  |     ************
search RasMol script viewer Motif-ligand binding stats  nest ..|  |  |  |                                ***                |  |                          |  |  |  |                     *** **** |  |    ***    *** |  | |     |  |   |  |      ***              |   ***   |  |          ***    |  |         |  |  |  |                 
search RasMol script viewer Motif-ligand binding stats  niche ..****  ****                                                   ****                          ****  ****                           |  ****            ****  ***     ****   ****                       |   |     ****                 ****         ****  ****                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                |                                                                  *****                                                                  
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                *                                                                                                                                         

   New search    1qpj:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML