triangle PDBeMotif: 1qpc  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.1.112
Classification transferase    | release date: Fri, May 21, 1999
Title structural analysis of the lymphocyte-specific kinase lck in with non-selective and src family selective kinase inhibito
Authors D.R.STOVER, H.ZHAO, J.L.KIM, K.A.MORG, L.M.TOLEDO, P.E.ROSE, X.ZHU
Method X-RAY DIFFRACTION (resolution: 1.60Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4   search ANP ANP binding statistics ANP   search EDO EDO binding statistics EDO
Modified residues:  search PTR PTR binding statistics PTR
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
KPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLYAVVTQE
PIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIE
DNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELY
QLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQPQP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : LCK KINASE
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF204PFAM:searchPF07714PRINTS:searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109, PROSITE PROFILES:searchPS50011, SMART:searchSM00219SUPERFAMILY:searchSSF55550/searchSSF56112UniProt:searchP06239
JMol viewer RasMol script viewer  EDO 905A  ..                                          *              *   *                                                                                        ***                                                                                                                       
JMol viewer RasMol script viewer  ANP 904A  ..                    *       *           * |              |   |                        ***   *                                               *         |||                                                                                                                       
JMol viewer RasMol script viewer  SO4 903A  ..                    |       |           | |              |   |                        |||   |                                               |         |||                         *  **                                    *  **                                                
JMol viewer RasMol script viewer  SO4 902A  ..                    |       |           | |              |   |                        |||   |      ***                                      |         |||                         |  ||                                    |  ||                                                
JMol viewer RasMol script viewer  SO4 901A  ..                    |       |           | |              |   |     **                 |||   |      |||                                      |     * * |||                         |  ||                                    |  ||                                                
sec str:  ............hhh.eeeeeeeeee..eeeeeeee...eeeeeeee.....hhhhhhhhhhhhhhh.......eeeee.....eeeee.....hhhhhh.hhhhhh.hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee...................hhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhh.
sequence :  ..KPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATE
seq num:  ..231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. || ||  |  | ||| || ||                    || | |||| |             |  |      | |           ^*** ||  |  || |||  |                | | | | || || || ||| |  ||| ||      || || |  ||  |  |   | | | ||     |   ||  | |   |  ||  ||   | |||    |  |        || || || || |   | |  | | | ||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. || ||  |  | ^** || ||                    |^** |||| |             |  |      | |             |  ||  |  || |||  |                | | | | || || || ||^**  ||| ||      |^**| |  ||  |  |   | | ^**|     |   ||  | |   |  ||  ||   | |||    |  |        || || || || |   | |  | | | ||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. || ||  |  |  |  || ||                    |  | |||| |             |  |      | |             ^***|  |  || |||  |                | | | | || || || |||    ||| ||      |^*** |  ||  ^***   | | |  |     |   ||  | |   |  |^***|   | |||    |  |        || || || || |   | ^*** | ^***
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. || ||  |  |  |  || ||                    |  | |||| |             |  |      | |                 |  |  || |||  |                | | | | || || || |||    ||| |*******^  |  |  ||  |      | | |  |     |   ||  | |   |  ||   |   | |||    |  |        || || || || |   |    | | | | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. || ||  |  |  |  || ||                    |  | |||| |             |  |      | |                 |  |  ^*****  |                | | | | || || || |||    ||| |          |  |  ||  |      | | |  |     ^*****  | |   |  ||   |   | |||    |  |        || || || || |   |    | | | | 
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP .. || ||  |  |  |  || ***********************  | |||| |             |  |      | |                 |  |  || ||   |                | | | | || || || |||    ||| |          |  |  ||  |      | | |  |         |   | |   |  ||   |   | |||    |  |        || || || || |   |    | | | | 
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_TYR .. || ||  |  |  |  || ||                       | |||| |             |  |      | |                 |  |  || ||   |                | ****^********| |||    ||| |          |  |  ||  |      | | |  |         |   | |   |  ||   |   | |||    |  |        || || || || |   |    | | | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. *****  |  |  |  || ||                       | |||| |             |  |      | |                 |  |  || ||   |                | | | | || ||  | |||    ||| |          |  |  ||  |      | | |  |         |   | |   |  ||   |   | |||    |  |        || || || || |   |    | | | | 
search RasMol script viewer Motif-ligand binding stats  asxturn .. || ||  |  |  |  || ||                       | |||| |             |  |      | |                 |  |  || ||   |                | | | | || ||  | |||    *** |          |  |  ||  |      | | |  |         |   | |   |  ||   |   | |||    |  |        || || || || |   |    | | | | 
search RasMol script viewer Motif-ligand binding stats  betabulge .. || ||  |  |  |  ** **                       | |||| |             |  |      | |                 |  |  || ||   |                | | | | || ||  | |||    ||| |          |  |  ||  |      | | |  |         |   | |   |  ||   |   | |||    |  |        || || || || |   |    | | | | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. || ||  |  |  |                              | |||| |             |  |      | |                 |  |  || ||   |                | | | | || ||  *****    ||| |          |  |  ||  |      | | |  |         |   | |   |  ||   |   | |||    |  |        || || || || |   |    | | | | 
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****|  |  |  |                              ****|| |             |  |      | |                 ****  || ||   |                | | | | ****|  ****|    |****          ****  ||  |      | | ****         |   | |   ****|   |   ****|    |  |        ****| ***** |   |    | | | | 
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |  |  |  |                                ***| |             |  |      | |                 |  |  || ||   |                *** ***  |  |    ***    *** |          |  |  ||  |      ***              |   ***   |  ||   |     ***    |  |         |  | ||  | |   |    | | | | 
search RasMol script viewer Motif-ligand binding stats  niche ..  *******  ****                                   | |             ****      ***                 ****  ****|   |                      |  ****            ****          ****  |****                       |   |     ****|   |            ****         ********** |   |    | | | | 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                  | |                                              *****  *****                      |                                      |   |                       |   |         *****                                    *****    | | | | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                  | |                                                                                |                                      *****                       *****                                                           ******* 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                  ***                                                                                |                                                                                                                                          
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                     *                                                                                                                                          

   New search    1qpc:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML