triangle PDBeMotif: 1qls  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification metal-binding protein/inhibitor    | release date: Wed, Sep 15, 1999
Title s100c (s100a11),or calgizzarin, in complex with annexin i n-terminus
Authors A.LEWIT-BENTLEY, D.OSTERLOH, F.RUSSO-MARIE, J.SOPKOVA, M.RENOUARD, S.RETY, V.GERKE
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search ACE ACE binding statistics ACE   search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MAKRPTETERCIESLIAIFQKHAGRDGNNTKISKTEFLIFMNTELAAFTQNQKDPGVLDRMMKKLDLDSDGQLDFQEFLN
LIGGLAIACHDSFIKSTQK
Chain D sequence:
AMVSAFLKQAW
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : S100C PROTEIN
member of: CATH:search1.10.238.10GENE3D:searchG3DSA_1.10.238.10PANTHER:searchPTHR11639/searchPTHR11639_SF7PFAM:searchPF00036/searchPF01023PROSITE PATTERNS:searchPS00018/searchPS00303, PROSITE PROFILES:searchPS50222, SUPERFAMILY:searchSSF47473UniProt:searchP31950
JMol viewer RasMol script viewer  CA 102A  ..                                                             * * * *    *                      
JMol viewer RasMol script viewer  CA 101A  ..                  *  * *  *    *                             | | | |    |                      
JMol viewer RasMol script viewer  ACE 0D  ..*   *   *         |  | |  |    |                             | | | |    |                      
sec str:  ...hhhhhhhhhhhhhhhhhhh......eeehhhhhhhhhh..hhhhhh....hhhhhhhhhh......eeehhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..PTETERCIESLIAIFQKHAGRDGNNTKISKTEFLIFMNTELAAFTQNQKDPGVLDRMMKKLDLDSDGQLDFQEFLNLIGGLAIACHDSFIKSTQK
seq num:  ..5         15        25        35        45        55        65        75        85        95   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|| |||                 ^*** | ||  |   | |   |  | |  |  ||   |||||||| |  ||   | |    |       | |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..^* |||                 |  | | ||  |   | |   |  | |  |  ||   |||||||| |  ||   | |    |       | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ^**                 |  | | ||  |   | |   |  | |  |  ||   |||||||| |  ||   | |    |       ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***|                 |  | ^***  |   | |   |  | |  |  ||   |||||||| |  ||   | |    |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |   |                 |  | | |   |   | |   |  | |  |  ||   |||||||| |  ||   | ^*****          
search RasMol script viewer Motif-ligand binding stats  EF_HAND_1 .. |   |                 |  | | |   |   | |   |  | |  |  ||   |^*^*^*^*^**^*   |                 
search RasMol script viewer Motif-ligand binding stats  S100_CABP .. |   |                 |  | | |   |   | |   |  | |  |  |**********************                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |   |                 |  | | |   |   | |   |  | |  *****   | |||||| |   |                     
search RasMol script viewer Motif-ligand binding stats  asxmotif .. |   |                 |  | | |   |   | |   |  | |  |  |    | |||||| *****                     
search RasMol script viewer Motif-ligand binding stats  betaturn .. |   |                 |  | | |   |   | |   |  | |  ****    | ||||||                           
search RasMol script viewer Motif-ligand binding stats  gammaturn .. |   |                 |  | | |   |   | |   |  | |          ***|||||                           
search RasMol script viewer Motif-ligand binding stats  nest .. |   |                 |  | | |   |   | |   |  | |             *****                           
search RasMol script viewer Motif-ligand binding stats  niche .. |   |                 **** | |   |   | |   |  ***                                             
search RasMol script viewer Motif-ligand binding stats  stmotif .. *****                      | |   |   | |   |                                                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                            | |   ***** *****                                                  
search RasMol script viewer Motif-ligand binding stats  stturn ..                            ***                                                                

chain D : ANNEXIN I
member of: PANTHER:searchPTHR10502/searchPTHR10502_SF17PRINTS:searchANNEXINISUPERFAMILY:searchSSF47874UniProt:searchP04083
JMol viewer RasMol script viewer  ACE 0D  ..* **       
sec str:  ...hhhhhhhh..
sequence :  ..AMVSAFLKQAW
seq num:  ..1          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     ***** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****| 
search RasMol script viewer Motif-ligand binding stats  niche ..      **** 

   New search    1qls:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors