triangle PDBeMotif: 1qdl  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   4.1.3.27
Classification lyase    | release date: Thu, May 20, 1999
Title the crystal structure of anthranilate synthase from sulfolobus solfataricus
Authors A.GONZALEZ, A.IVENS, G.HESTER, J.N.JANSONIUS, K.KIRSCHNER, M.WILMANNS, R.BAUERLE, T.KNOECHEL
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
AMEVHPISEFASPFEVFKCIERDFKVAGLLESIGGPQYKARYSVIAWSTNGYLKIHDDPVNILNGYLKDLKLADIPGLFK
GGMIGYISYDAVRFWEKIRDLKPAAEDWPYAEFFTPDNIIIYDHNEGKVYVNADLSSVGGCGDIGEFKVSFYDESLNKNS
YERIVSESLEYIRSGYIFQVVLSRFYRYIFSGDPLRIYYNLRRINPSPYMFYLKFDEKYLIGSSPELLFRVQDNIVETYP
IAGTRPRGADQEEDLKLELELMNSEKDKAEHLMLVDLARNDLGKVCVPGTVKVPELMYVEKYSHVQHIVSKVIGTLKKKY
NALNVLSATFPAGTVSGAPKPMAMNIIETLEEYKRGPYAGAVGFISADGNAEFAIAIRTAFLNKELLRIHAGAGIVYDSN
PESEYFETEHKLKALKTAIGVR
Chain B sequence:
MDLTLIIDNYDSFVYNIAQIVGELGSYPIVIRNDEISIKGIERIDPDRLIISPGPGTPEKREDIGVSLDVIKYLGKRTPI
LGVCLGHQAIGYAFGAKIRRARKVFHGKISNIILVNNSPLSLYYGIAKEFKATRYHSLVVDEVHRPLIVDAISAEDNEIM
AIHHEEYPIYGVQFHPESVGTSLGYKILYNFLNRV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (ANTHRANILATE SYNTHASE (TRPE-SUBUNIT))
member of: CATH:search3.60.120.10GENE3D:searchG3DSA_3.60.120.10PANTHER:searchPTHR11236PFAM:searchPF00425/searchPF04715PRINTS:searchANTSNTHASEISUPERFAMILY:searchSSF56322TIGRFAMS:searchTIGR01820UniProt:searchQ06128
sec str:  ...eeeee.hhh.hhhhhhhhhhhhh........................eee..hhhhhhhh................eeeeee.hhhhhhh...............eeee.............eeeee........................hhhhhhhhhhhhhhhhhhh..................hhhhhhhhhhhh.....................eeeeee..eeee..eeeeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeeeeeee...eeeeeeeeeee.....hhhhhhhhhh.hhhh...hhhhhhhhhhhhh........eeeeeee....eeeeee.......................hhhhhhhhhhhhhhhhhhhh...
sequence :  ..AMEVHPISEFASPFEVFKCIERDFKVAGLLESIG..RYSVIAWSTNGYLKIHDDPVNILNGYLKDLKLADIPGLFKGGMIGYISYDAVRFWEKIRDLKPAAEDWPYAEFFTPDNIIIYDHNEGKVYVNADLSSVGGCGDIGEFKVSFYDESLNKNSYERIVSESLEYIRSGYIFQVVLSRFYRYIFSGDPLRIYYNLRRINPSPYMFYLKFDEKYLIGSSPELLFRVQDNIVETYPIAGTRPRGADQEEDLKLELELMNSEKDKAEHLMLVDLARNDLGKVCVPGTVKVPELMYVEKYSHVQHIVSKVIGTLKKKYNALNVLSATFPAGTVSGAPKPMAMNIIETLEEYKRGPYAGAVGFISADGNAEFAIAIRTAFLNKELLRIHAGAGIVYDSNPESEYFETEHKLKALKTAIGVR
seq num:  ..-1        10        20        30  ..40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |  |  |  |     |  |   |    | ..                 | |      |  |      | |  |     |  |        | |       |            |  |||           | |       |  |   | |   |   |  ||  ||||||              |  |         | |             || | ||                        |  || ||  ^**|               |  || |^**     |        |       ^**  |    | | || ||  | |         || ||   ||| |       | |     |  |                |  || | |            | ||||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |  |  ^***     |  |   |    | ..                 | |      |  |      | |  |     |  |        | |       |            |  |||           | |       ^***   | |   |   |  ||  ||||||              |  |         | |             ^*** ||                        |  || ||  ^***               |  || ||||     |        |         |  |    | | || ||  | |         |^***   ||| |       | |     |  |                |  ^*** |            | ||||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |  |           |  |   |    | ..                 | |      |  |      | |  |     |  |        | ********^            |  |||           | |              | |   ********^  ||||||              |  |         | |              | | ||                        |  || ||  |                  |  || |||******^        |         |  |    | | || ||  | |         |  |    ||| |       | |     |  |                |  ||   |            | ||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  |           |  |   ^***** ..                 | |      |  |      ^*****     |  |        | |                    |  |||           | |              | |       |  |   ||||||              |  |         | |              | | ||                        |  || ||  |                  |  || |||               |         |  |    | | || |^*****         |  |    ||| |       | |     |  |                |  ||   |            | ||||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     |  |           |  |          ..                 | |      |  |      | |        |  |        | |                    *****|           | |              | |       |  |   ||||||              |  |         | |              | | ||                        ********  |                  |  || |||               |         |  |    | | || |   |           |  |    ||| |       | |     |  |                |  ||   |            | ||||
search RasMol script viewer Motif-ligand binding stats  asxmotif ..     |  |           |  |          ..                 | |      |  |      | |        |  |        | |                    |  | |           | |              | |       |  |   ||||||              |  |         | |              | | ||                        |  |  ||  |                  |  || |||               |         |  |    | | || |   |           |  |    ||| |       | |     |  |                |  |*****            | ||||
search RasMol script viewer Motif-ligand binding stats  asxturn ..     |  |           |  |          ..                 ***      |  |      | |        |  |        | |                    |  | |           | |              ***       |  |   ||||||              |  |         | |              | | ||                        |  |  ||  |                  |  || |||               |         |  |    | | || |   |           |  |    ||| |       ***     |  |                |  |                 | ||||
search RasMol script viewer Motif-ligand binding stats  betabulge ..     |  |           |  |          ..                          |  |      | |        |  |        | |                    |  | |           | |                        |  |   ||||**              |  |         | |              | | **                        |  |  ||  |                  |  || |||               |         |  |    | | || |   |           |  |    ||| |       | |     |  |                |  |                 | ||||
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..     |  |           |  |          ..                          |  |      | |        |  |        | |                    ******           | |                        |  |   ||||                |  |         | |              | |                           |  |  ||  |                  |  || |||               |         |  |    | | || |   |           |  |    ||| |       | |     |  |                |  |                 | ||||
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****           |  |          ..                          |  |      | |        ****        | |                    **** |           | |                        ****   ||||                ****         | |              | |                           ***********                  |  |****|               |         |  |    | | || |   |           |  |    |****       | |     |  |                |  |                 ****||
search RasMol script viewer Motif-ligand binding stats  nest ..                    |  |          ..                          |  |      | |                    | |                       ***           ***                           |   ****                             | |              | |                                  |  |                  |  |  ***               |         |  |    | | || |   |           |  |    | |         ***     |  |                |  |                   ****
search RasMol script viewer Motif-ligand binding stats  niche ..                    ****          ..                          ****      ***                    ***                                                                   |   |                                | |              | |                                  ****                  ****  ***               |         ****    | **** |   |           ****    ***                 ****                ****                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                  ..                                                                                                                                 *****                                | |              | |                                                                                |                 *****  *****                                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                  ..                                                                                                                                                                      ***              ***                                                                                |                                                                                                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                  ..                                                                                                                                                                                                                                                                          *                                                                                                                   

chain B : PROTEIN (ANTHRANILATE SYNTHASE (TRPG-SUBUNIT))
member of: CATH:search3.40.50.880GENE3D:searchG3DSA_3.40.50.880PANTHER:searchPTHR11922PFAM:searchPF00117PRINTS:searchANTSNTHASEII/searchCPSGATASE/searchGATASEPROSITE PROFILES:searchPS51273, SUPERFAMILY:searchSSF52317TIGRFAMS:searchTIGR00566UniProt:searchQ06129
sec str:  ....eeeeee....hhhhhhhhhhhh..eeeeee....hhhhhhhhh..eeee........hhhhhhhhhhhhhhhh....eeeehhhhhhhhhhh..eeeeeeeeeeeeeeeeee..............eeeeeeeeeeeee.....eeeeeee.....eeeeee....eeee..........hhhhhhhhhhhhh
sequence :  ..MDLTLIIDNYDSFVYNIAQIVGELGSYPIVIRNDEISIKGIERIDPDRLIISPGPGTPEKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNIILVNNSPLSLYYGIAKEFKATRYHSLVVDEVHRPLIVDAISAEDNEIMAIHHEEYPIYGVQFHPESVGTSLGYKILYNFLNRV
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          | |  |       | |          ^** |            |  | ||   |  |      || ||   | |  |      | |        |  |     | |    | || |         |        | |     |  | |     |  |    | || || |||  |       | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | |  |       | |          |   |            |  | ||   |  |      || ||   | |  |      | |        |  |     | |    | || |         |        | |     ^*** |     |  |    | || || |||  |       | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | |  |       | |          |   |            |  | ||   |  |      || ||   ^*****      | |        |  |     | |    | || |         |        | |        | |     |  |    | || || ^*****       | |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..          | |  |       | |          |   |            |  | ||   |  |      ^***|     |         | |        |  |     | |    | || |         |        | |        | |     |  |    | || || |||          | |
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..          | |  |       | |          |   |            |  | ||   |  |       |  |     |         | |        |  |     | |    | || |         |        | |        | |     |  |    | || || |||          ***
search RasMol script viewer Motif-ligand binding stats  DEAH_ATP_HELICASE ..          | |  |       | |          |   |            |  | ||   |  |       |  |     |         | |        |  |     | |    | || |         ********** |        | |     |  |    | || || |||             
search RasMol script viewer Motif-ligand binding stats  asxturn ..          ***  |       | |          |   |            |  | ||   |  |       |  |     |         | |        |  |     | |    | || |                  | |        | |     |  |    | || || |||             
search RasMol script viewer Motif-ligand binding stats  betaturn ..            ****       | |          |   |            |  | ||   ****       |  |     |         | |        |  |     | |    | || |                  | |        | |     |  |    | || |****|             
search RasMol script viewer Motif-ligand binding stats  nest ..                       ***          |   |            |  | ||              |  |     |         ***        |  |     | |    | || |                  | |        ***     |  |    | || || |||             
search RasMol script viewer Motif-ligand binding stats  niche ..                                    |   |            |  ****              ****     |                    ****     ***    ******                  ***                ****    **********|             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                    *****            |  | |                        |                                                                                          | |*****             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                     |  ***                        |                                                                                          | |***               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                     *                             *                                                                                          * *                  

   New search    1qdl:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors