triangle PDBeMotif: 1pya  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   4.1.1.22
Classification carboxy-lyase    | release date: Fri, Dec 18, 1992
Title refined structure of the pyruvoyl-dependent histidine decarboxylase from lactobacillus 30a
Authors D.A.ROZWARSKI, M.L.HACKERT, S.R.ERNST, T.GALLAGHER
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Small molecules:    search PYR PYR binding statistics PYR
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,C,E sequence:
SELDAKLNKLGVDRIAISPYKQWTRGYMEPGNIGNGYVTGLKVDAGVRDKSDDDVLDGIVSYDRAETKNAYIGQINMTTA
S
Chains B,D,F sequence:
FTGVQGRVIGYDILRSPEVDKAKPLFTETQWDGSELPIYDAKPLQDALVEYFGTEQDRRHYPAPGSFIVCANKGVTAERP
KNDADMKPGQGYGVWSAIAISFAKDPTKDSSMFVEDAGVWETPNEDELLEYLEGRRKAMAKSIAECGQDAHASFESSWIG
FAYTMMEPGQIGNAITVAPYVSLPIDSIPGGSILTPDKDMEIMENLTMPEWLEKMGYKSLSANNALKY
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PYRUVOYL-DEPENDENT HISTIDINE DECARBOXYLASE (L-HISTIDINE CARBOXYLASE);
member of: GENE3D:searchG3DSA_4.10.510.10PFAM:searchPF02329PIRSF:searchPIRSF001341PRODOM:searchPD024462SUPERFAMILY:searchSSF56271TIGRFAMS:searchTIGR00541UniProt:searchP00862
JMol viewer RasMol script viewer  PYR 82F  ..                                                                           *     
JMol viewer RasMol script viewer  PYR 82B  ..                                                                           |     
sec str:  ....hhhhhhh......eee.............eee..eeeeeeeeeeeeee..hhhhhhhhhhhhhhhh.....eeeeeee.
sequence :  ..SELDAKLNKLGVDRIAISPYKQWTRGYMEPGNIGNGYVTGLKVDAGVRDKSDDDVLDGIVSYDRAETKNAYIGQINMTTAS
seq num:  ..1         11        21        31        41        51        61        71         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |  || |||| |  | |     |  | ||   |              | |||     |  ||  |   |  |^***| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***  || |||| |  | |     |  | ||   |              ^***|     |  ||  |   |  |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      || |||| |  | |     |  | ^*****              | | |     |  ||  |   |  |    | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      || |||| |  | |     |  |  |                  | | |     *****  |   |  |    | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..      || |||***  | |     |  |  |                  | ***     |  ||  |   |  |    | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..      *****|| |  | |     |  ****                  | |       ********   |  |    | 
search RasMol script viewer Motif-ligand binding stats  nest ..         ***| |  | |     |  |  |                  | |       |   |  |   |  |    | 
search RasMol script viewer Motif-ligand binding stats  niche ..            ***  ***     *******                  | |       |   ****   ****    | 
search RasMol script viewer Motif-ligand binding stats  stturn ..                 ***                              ***       |                  | 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                            *                  * 

chain B : PYRUVOYL-DEPENDENT HISTIDINE DECARBOXYLASE (L-HISTIDINE CARBOXYLASE);
member of: GENE3D:searchG3DSA_3.50.20.10PFAM:searchPF02329PIRSF:searchPIRSF001341PRODOM:searchPD024462SUPERFAMILY:searchSSF56271TIGRFAMS:searchTIGR00541UniProt:searchP00862
JMol viewer RasMol script viewer  PYR 82B  ..*                                                                                                              **                                                                                                                   
sec str:  ........eee.................eeee..eeeeeeeeehhhhhhhhhheee..eee.....eeeeeeeeeeeeeee............eeeeeeeeeee........eeeeeeeeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeeeeee..eeeeeeeeeeeeeee.............hhhhhhhhhhhhhhhhhhhh............
sequence :  ..FTGVQGRVIGYDILRSPEVDKAKPLFTETQWDGSELPIYDAKPLQDALVEYFGTEQDRRHYPAPGSFIVCANKGVTAERPKNDADMKPGQGYGVWSAIAISFAKDPTKDSSMFVEDAGVWETPNEDELLEYLEGRRKAMAKSIAECGQDAHASFESSWIGFAYTMMEPGQIGNAITVAPYVSLPIDSIPGGSILTPDKDMEIMENLTMPEWLEKMGYKSLSANNALKY
seq num:  ..83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  | | |||      |  |      |  | |         |  ||  |  |  |     |  |                | | | || |||           |  |  | |       | ||| ||  ||  |   | ||||  | |||           |  | ||   |          |  |  |    |  | ||||^*** |||| |||      | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  | | |||      |  |      ^*** |         |  ||  |  ^***     |  |                | | | || |||           |  |  | |       ^***| ||  ||  |   | ^***  | |||           ^*** ||   |          |  |  |    |  | ||||||^***||| |||      | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  | | |||      |  |         | |         |  ||  |           |  |                | | | ^*****           |  |  | |       | | | ||  ||  |   |  ||   | |||              | ^*****          |  |  |    |  | |||||| |  ||| |||      | |  
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |  | | |||      |  |         | |         |  ||  |           |  |                | | |  | ||            |  |  | |       | | | ||  |^***   |  ||   | |||              |  |              |  |  |    |  | |||||| |  ||| |||      | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  | | |||      |  |         | |         |  ||  |           |  |                | | |  | ||            |  |  | |       | | | |*****      *****   | |||              |  |              |  |  |    |  | ****** *****| |||      | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  | | |||      |  |         | |         |  ||  |           |  |                | | |  | ||            |  |  | |       | *****|  |       |  |    | |||              |  |              |  |  |    |  | |||||| |  ||| |||      | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  | | |||      |  |         | |         |  ||  |           |  |                | | |  | ||            |  |  | |       | ***  |  |       |  |    | |||              |  |              |  |  |    |  | |||||| |  ||| |||      | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..  |  | | |||      |  |         | |         |  ||  |           |  |                | | |  | **            |  |  | |       | |    |  |       |  |    | |||              |  |              |  |  |    |  | |||||| |  ||| |||      | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  | ****|      ****         | |         ********           ****                | | ****               |  |  | |       | |    ****       ****    ****|              ****              *******    **********| ****|****|      | |  
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |   ***      |  |         ***                            |  |                | | |  |               |  |  | |       | |                         ***              |  |              |  |  |           |  |     |  ***      ***  
search RasMol script viewer Motif-ligand binding stats  niche ..  ****            ****                                        ****                *** ****               ****  | |       ***                                          ****              *******           ****     |    |      ***  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                               | |                                                                                                 ******           
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                               * *                                                                                                                  

chain C : PYRUVOYL-DEPENDENT HISTIDINE DECARBOXYLASE (L-HISTIDINE CARBOXYLASE);
member of: GENE3D:searchG3DSA_4.10.510.10PFAM:searchPF02329PIRSF:searchPIRSF001341PRODOM:searchPD024462SUPERFAMILY:searchSSF56271TIGRFAMS:searchTIGR00541UniProt:searchP00862
JMol viewer RasMol script viewer  PYR 82D  ..                                                                                 
JMol viewer RasMol script viewer  PYR 82B  ..                                                                           *     
sec str:  ....hhhhhhh......eee.............eee..eeeeeeeeeeeeee..hhhhhhhhhhhhhhhh.....eeeeeee.
sequence :  ..SELDAKLNKLGVDRIAISPYKQWTRGYMEPGNIGNGYVTGLKVDAGVRDKSDDDVLDGIVSYDRAETKNAYIGQINMTTAS
seq num:  ..1         11        21        31        41        51        61        71         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| ||  || |||| |  | |     |  | ||   |              | ||| ||  |  || ||  ||| |^***| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***  || |||| |  | |     |  | ||   |              ^***| ||  |  || ||  ||| |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| |   || |||| |  | |     |  | ^*****              | ||| ||  |  || ||  ||| |    | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| |   || |||| |  | |     |  |  |                  | |*****  |  *****  ||| |    | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..| |   || |||***  | |     |  |  |                  | *** |   |  || ||  ||| |    | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..| |   *****|| |  | |     |  |  |                  | |****   |  ****|  ||| |    | 
search RasMol script viewer Motif-ligand binding stats  nest ..| |      ***| |  | |     |  |  |                  | |       |   |  |  ||| |    | 
search RasMol script viewer Motif-ligand binding stats  niche ..| |         ***  ***     *******                  | |       |   ****  *****    | 
search RasMol script viewer Motif-ligand binding stats  stturn ..***              ***                              ***       |                  | 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                            *                  * 

chain D : PYRUVOYL-DEPENDENT HISTIDINE DECARBOXYLASE (L-HISTIDINE CARBOXYLASE);
member of: GENE3D:searchG3DSA_3.50.20.10PFAM:searchPF02329PIRSF:searchPIRSF001341PRODOM:searchPD024462SUPERFAMILY:searchSSF56271TIGRFAMS:searchTIGR00541UniProt:searchP00862
JMol viewer RasMol script viewer  PYR 82D  ..*                                                                     *                                         *                                                                                                                   
sec str:  ........eee.................eeee..eeeeeeeeehhhhhhhhhheee..eee.....eeeeeeeeeeeeeee............eeeeeeeeeee........eeeeeeeeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeeeeee..eeeeeeeeeeeeeee.............hhhhhhhhhhhhhhhhhhhh............
sequence :  ..FTGVQGRVIGYDILRSPEVDKAKPLFTETQWDGSELPIYDAKPLQDALVEYFGTEQDRRHYPAPGSFIVCANKGVTAERPKNDADMKPGQGYGVWSAIAISFAKDPTKDSSMFVEDAGVWETPNEDELLEYLEGRRKAMAKSIAECGQDAHASFESSWIGFAYTMMEPGQIGNAITVAPYVSLPIDSIPGGSILTPDKDMEIMENLTMPEWLEKMGYKSLSANNALKY
seq num:  ..83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  |   | |  |   |  |      |  | |         |  |      |  |     |  |                | | | || |||           |  |  | |       | |||  |  || ||     | || || |||           |  | ||   |          |  |  |    |  || || ^*** ||||||||      | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |   | |  |   |  |      ^*** |         |  |      ^***     |  |                | | | || |||           |  |  | |       ^***|  |  || ||     ^*** || |||           ^*** ||   |          |  |  |    |  || ||  |^***|||||||      | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |   | |  |   |  |         | |         |  |               |  |                | | | ^*****           |  |  | |       | | |  |  || ||       |  || |||              | ^*****          |  |  |    |  || ||  | | ||||||||      | |  
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |  |   | |  |   |  |         | |         |  |               |  |                | | |  | ||            |  |  | |       | | |  |  |^***       |  || |||              |  |              |  |  |    |  || ||  | | ||||||||      | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |   | |  |   |  |         | |         |  |               |  |                | | |  | ||            |  |  | |       | | |  ********       ***** |||              |  |              |  |  |    ***** ||  | *******|||      | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |   | |  |   |  |         ***         |  |               |  |                *** |  | ||            |  |  | |       | ***  |  |  |        |  || |||              |  |              |  |  |    |  |  ||  | | |||| |||      | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..  |  |   | |  |   |  |         | |         |  |               |  |                | | |  | **            |  |  | |       | |    |  |  |        |  || |||              |  |              |  |  |    |  |  ||  | | |||| |||      | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |   | |  |   |  |         | |         ****               |  |                | | ****               |  |  | |       | |    *******        ********|              ****              |  ****    *******|  | *********|      | |  
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |   ***  |   |  |         ***                            |  |                | | |  |               |  |  | |       | |                      |  ***              |  |              |  |  |           |  |     |  ***      ***  
search RasMol script viewer Motif-ligand binding stats  niche ..  ****     ****   ****                                        ****                *** ****               ****  | |       ***                      |    |              ****              *******           ****     |    |      ***  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                               | |       | |                      ******                                                           ******           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                               | |       ***                                                                                                        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                               * *                                                                                                                  

chain E : PYRUVOYL-DEPENDENT HISTIDINE DECARBOXYLASE (L-HISTIDINE CARBOXYLASE);
member of: GENE3D:searchG3DSA_4.10.510.10PFAM:searchPF02329PIRSF:searchPIRSF001341PRODOM:searchPD024462SUPERFAMILY:searchSSF56271TIGRFAMS:searchTIGR00541UniProt:searchP00862
JMol viewer RasMol script viewer  PYR 82F  ..                                                                                 
JMol viewer RasMol script viewer  PYR 82D  ..                                                                           *     
sec str:  ....hhhhhhh......eee.............eee..eeeeeeeeeeeeee..hhhhhhhhhhhhhhhh.....eeeeeee.
sequence :  ..SELDAKLNKLGVDRIAISPYKQWTRGYMEPGNIGNGYVTGLKVDAGVRDKSDDDVLDGIVSYDRAETKNAYIGQINMTTAS
seq num:  ..1         11        21        31        41        51        61        71         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |  |  | || |  | |  |  |  | ||   |              | ||||| ||| |||| |  ||| |^***| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***  |  | || |  | |  |  |  | ||   |              ^***||| ||| |||| |  ||| |    | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  |  | || |  | |  |  |  | ^*****                | ||| ||| |||| |  ||| |    | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |  | || |  | |  |  |  |  |                    | ||| ||*****| |  ||| |    | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  |  | |***  | |  |  |  |  |                    ***|| ||| |||| |  ||| |    | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ******* || |  | |  |  |  |  |                       *********** |  ||| |    | 
search RasMol script viewer Motif-ligand binding stats  nest ..         ***| |  | |  |  |  |  |                        |   |   |  |  ||| |    | 
search RasMol script viewer Motif-ligand binding stats  niche ..            ***  ******  *******                        |   |   ****  *****    | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 | |                                    *****                  | 
search RasMol script viewer Motif-ligand binding stats  stturn ..                 ***                                        |                  | 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                            *                  * 

chain F : PYRUVOYL-DEPENDENT HISTIDINE DECARBOXYLASE (L-HISTIDINE CARBOXYLASE);
member of: GENE3D:searchG3DSA_3.50.20.10PFAM:searchPF02329PIRSF:searchPIRSF001341PRODOM:searchPD024462SUPERFAMILY:searchSSF56271TIGRFAMS:searchTIGR00541UniProt:searchP00862
JMol viewer RasMol script viewer  PYR 82F  ..*                                                                                                               *                                                                                                                   
sec str:  ........eee.................eeee..eeeeeeeeehhhhhhhhhheee..eee.....eeeeeeeeeeeeeee............eeeeeeeeeee........eeeeeeeeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeeeeee..eeeeeeeeeeeeeee.............hhhhhhhhhhhhhhhhhhhh............
sequence :  ..FTGVQGRVIGYDILRSPEVDKAKPLFTETQWDGSELPIYDAKPLQDALVEYFGTEQDRRHYPAPGSFIVCANKGVTAERPKNDADMKPGQGYGVWSAIAISFAKDPTKDSSMFVEDAGVWETPNEDELLEYLEGRRKAMAKSIAECGQDAHASFESSWIGFAYTMMEPGQIGNAITVAPYVSLPIDSIPGGSILTPDKDMEIMENLTMPEWLEKMGYKSLSANNALKY
seq num:  ..83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  |   | |   |  |  |      |  | |         |  ||  |  |  |     |  |                | |   |    |           |  |  | |       | ||| ||  ||  |||||||||||   | |           |  | ||   |          |  |  ||  ||  || || ^*** |  | |||      | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |   | |   |  |  |      ^*** |         |  ||  |  ^***     |  |                | |   |    |           |  |  | |       ^***| ||  ||  ||||||^***|   | |           ^*** ||   |          |  |  ||  ||  || ||  |^***  | |||      | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |   | |   |  |  |         | |         |  ||  |           |  |                | |   ^*****           |  |  | |       | | | ||  ||  |||||||||||   | |              | ^*****          |  |  ||  ||  || ||  |      | |||      | |  
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |  |   | |   |  |  |         | |         |  ||  |           |  |                | |                    |  |  | |       | | | ||  |^***||||||||||   | |              |  |              |  |  ||  ||  || ||  |      | |||      | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |   | |   |  |  |         | |         *****  |           |  |                | |                    |  |  | |       | | | |*****  |*********|   | |              |  |              |  |  ||  |***** ||  |      | |||      | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  |   | |   |  |  |         | |         |  ||  |           |  |                | |                    |  |  | |       | *****|  |   ||||||||| |   | |              |  |              |  |  ||  ||  |  ||  |      | |||      | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |   | |   |  |  |         | |         |  ||  |           |  |                | |                    |  |  | |       | ***  |  |   ||||||||| |   | |              |  |              |  |  ||  ||  |  ||  |      | |||      | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |   | |   ****  |         | |         ********           ****                | |                    |  |  | |       | |    ****   ***********   | |              ****              |  |  |***************      ****|      | |  
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |   ***      |  |         ***                            |  |                | |                    |  |  | |       | |             |   |       ***              |  |              |  |  |           |  |        ***      ***  
search RasMol script viewer Motif-ligand binding stats  niche ..  ****            ****                                        ****                ***                    ****  | |       ***             |   |                        ****              *******           ****                 ***  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                               | |       | |             *****                                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                               | |       ***                                                                                                        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                               * *                                                                                                                  

   New search    1pya:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors