triangle PDBeMotif: 1ps9  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.3.1.34
Classification oxidoreductase    | release date: Fri, Jun 20, 2003
Title the crystal structure and reaction mechanism of e. coli 2,4- dienoyl coa reductase
Authors H.SCHULZ, J.J.KIM, P.A.HUBBARD, X.LIANG
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search SF4 SF4 binding statistics SF4   search FMN FMN binding statistics FMN   search MDE MDE binding statistics MDE   search NAP NAP binding statistics NAP   search FAD FAD binding statistics FAD   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGIAPDLTGVGMEGGAMLNDASQI
PHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSALQAPINRFVPHELSHEEILQLIDNFARCAQLAREAGYDGVEV
MGSEGYLINEFLTLRTNQRSDQWGGDYRNRMRFAVEVVRAVRERVGNDFIIIYRLSMLDLVEDGGTFAETVELAQAIEAA
GATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDILSRGDADMVSMARPFLADAELL
SKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRACHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVT
LFDAHSEIGGQFNIAKQIPGKEEFYETLRYYRRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRTPPIDGIDHPKV
LSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIAGFCNEWGIDSSLQQAGGLSPQGMQIPRSPRQIVML
QRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKIDDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSG
KTVHLIGGCDVAMELDARRAIAQGTRLALEI
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : 2,4-DIENOYL-COA REDUCTASE
member of: CATH:search3.20.20.70/search3.40.50.720/search3.50.50.60GENE3D:searchG3DSA_3.20.20.70/searchG3DSA_3.50.50.60PANTHER:searchPTHR22893/searchPTHR22893_SF25PFAM:searchPF00724/searchPF07992PFAMB:searchPB007356PRINTS:searchFADPNR/searchPNDRDTASEISUPERFAMILY:searchSSF51395/searchSSF51905/searchSSF51971UniProt:searchP42593
JMol viewer RasMol script viewer  MDE 704A  ..                         *                                                                           * *                 **                                        * *        *                                                                            ** *  **                                                                                  *   *                                                                                                                                                                                                                           *      **  *                                                                                              
JMol viewer RasMol script viewer  NAP 703A  ..                         |                                                                           | |                 ||                                        | |        |                                                                            || |  ||                                                                               *  |   |                                                                                                                         * *                             *   **                                                       ***  |    * ||  |                  *                          ***                           ****               
JMol viewer RasMol script viewer  FMN 702A  ..                       ***                               *                                         * | |                 ||                                     *  | |        |                                      *                                     || |  ||                          ***                    ***                           | **  *|    *                                                                                                                    | |                             |   ||                                                       |||  |    | ||  |                  |                          |||                           ||||               
JMol viewer RasMol script viewer  FAD 701A  ..                       |||                               |                                         | | |                 ||                                     |  | |        |                                      |                                     || |  ||                          |||                    |||                           * ||  ||    |  *                        ** ***                  ***    *** **  *  *  *                     * *             ***   | |            *   *            |   ||  *                                                    |||  |    | ||  |                  |                          |||   *                 **    ||***              
JMol viewer RasMol script viewer  SF4 700A  ..                       |||                               |                                         | | |                 ||                                     |  | |        |                                      |                                     || |  ||                          |||                    ||*                      *****|**|  ||    | ***                       || |||                  |||    ||| ||  |  |  |                     | |             |||   | |            |   |            |   ||  |                                                    |||  |    | ||  |                  |                          |||   |                 ||    |||||              
JMol viewer RasMol script viewer  CL 707A  ..                       |||                               |                                         | | |                 ||                                     |  | |        |                                      |                                     || |  ||                          |||                    |||                      |||||||||  ||   *| |||     *                 || |||                  |||    ||| ||  |  |  |                     | |             |||   | |            |   |            |   ||  |                                                    |||  |    | ||  |                  |                          |||   |                 ||    |||||              
JMol viewer RasMol script viewer  CL 706A  ..                       |||                               |   **           *                        | | |                 ||                     *               |  | |        |                                      |                                     || |  ||                          |||                    |||                      |||||||||  ||   || |||     |                 || |||                  |||    ||| ||  |  |  |                     | |             |||   | |            |   |            |   ||  |                                                    |||  |    | ||  |                  |                          |||   |                 ||    |||||              
JMol viewer RasMol script viewer  CL 705A  ..                       |||                               |   ||           |                        | | |                 ||                     |               |  | |        |                                      |                                     || |  ||                          |||                    |||                      |||||||||  ||   || |||     |                 || |||                  |||*   ||| ||  |  |  |                     | |             |||   | |            |   |            |   ||  |                                                    |||  |    | ||  |                  |                          |||   |                 ||    |||||              
sec str:  ..........ee....ee...eee...........hhhhhhhhhhhhhhhh...eeeeeee................hhhhhhhhhhhhhhhhhh...eeeee..hhhhh.....ee.............ee.hhhhhhhhhhhhhhhhhhhhhh...eeeeee...hhhhhhhh............hhhhhhhhhhhhhhhhhhhhh...eeeeeeeee.......hhhhhhhhhhhhhhhh..eeeeee..................hhhhhhhhh......eee.....hhhhhhhhhhh....eeee.hhhhhh.hhhhhhhhhhhhhh.........hhhhhhh...........................eeeee..hhhhhhhhhhhhh...eeeeee.......hhhhhh......hhhhhhhhhhhhhhhhh.eeee.............eeee...eee............eeehhhhhh.......eeeee.hhhhhhhhhhhhh....hhhhhhhhhhhhh.......hhhhh............eeeee..............hhhhhhhhhhhh..eee...eeeeee..eeeeee..eeeee...eeee...eee...hhhhhhh....eee.hhhh.....hhhhhhhhhhhhhhhh
sequence :  ..SYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGIAPDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSALQAPINRFVPHELSHEEILQLIDNFARCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQRSDQWGGDYRNRMRFAVEVVRAVRERVGNDFIIIYRLSMLDLVEDGGTFAETVELAQAIEAAGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDILSRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRACHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIPGKEEFYETLRYYRRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRTPPIDGIDHPKVLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIAGFCNEWGIDSSLQQAGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKIDDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARRAIAQGTRLALEI
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  |       | || |  |   ||||                  | |          ||| |||  ||   |  |   | |||| || |||   |    ||||| |  |       |  | |     |  ||             || |||        | |   |  ||| | |                                    |  | |  | |  ||         | |        || |  |  |  |  | |   |||||||| |    | |  | |     ||||||      | |||| |  |   | || ||   |||||||     | |      |  |                    |    | |       | |  |  | |  ||||| ||  | |||  | | |    |   | || | ^***     | |    | |      | | ||||  | |  |   | |  | |  |          | | ||    |  |   |   |||| ||||  |          | |     |||||| |||| |            | |  |  |     |  |    |  |   | |       |    |  | |   | |      |  | | |     |  || | |||
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   |  |       | || |  |   ||||                  | |          ||| |||  ||   |  |   | |||| || |||   |    ||||| |  |       |  | |     |  ||             || |||        | |   |  ||| | |                                    |  | |  | |  ||         | |        || |  |  |  |  | |   |||||||| |    | |  | |     ||||||      | |||| |  |   | || ||   |||||||     | |      |  |                    |    | |       | |  |  | |  ||||| ||  | |||  | | |    |   | || |  |       | |    | |      | | ||||  | |  |   | |  | |  |          | | ||    |  |   |   |||| ||||  |          | |     |**^*| |||| |            | |  |  |     |  |    |  |   | |       |    |  | |   | |      |  | | |     |  || | |||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  |       ^**| |  |   ||||                  | |          ||| |||  ||   |  |   | |||| || |||   |    ^**|| |  |       |  | |     |  ||             || |||        | |   |  ^** | |                                    |  | |  | |  ||         | |        || |  |  |  |  | |   ^**||||| |    ^**  | |     ||||||      | |||| |  |   ^**| ||   |||||||     | |      |  |                    |    | |       | |  |  | |  ||||| ||  | |||  | ^**    |   | |^**  |       | |    | |      | | ||||  | |  |   | |  | |  |          | | ||    |  |   |   |||| ||||  |          ^**     | | || |||| |            | |  |  |     |  |    |  |   | |       |    |  | |   ^**      |  | | |     |  || | |||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  |          | |  |   ^***                  | |          ||| |||  ||   |  |   | ^*** || |||   |    || || |  |       |  | |     ^***|             || |||        | |   |  ||  | |                                    ^*** |  | ^***|         | |        || |  |  |  |  | |    | ||||| |         | |     |^***|      | |||| |  |   | || ||   |||||||     | |      |  |                    |    | |       | |  ^*** |  ||||| ||  | |||  |        |   | |  |  |       | |    | |      | | ||||  | ^***   | |  | |  |          | | ||    |  |   |   |||| ||||  |                  | | || |||| |            | |  |  |     |  |    |  |   | |       |    |  | |   |        |  | | |     |  || | |||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  |          | |  ^*****||                  | |          ||| |^*****   |  |   |  ||  || |^*****    || || |  |       |  | |     |   |             || |||        | |   |  ||  | |                                       | |  ^*****|         | |        || |  |  |  |  | |    | ||||| |         | |     | ||||      | |||| |  |   | || ||   |^*****     | |      |  |                    ^***** |       | |     | |  |^*****|  | |||  |        |   | |  |  |       | |    | |      | | ||||  |        | |  ^*****          | | ||    |  |   |   |^*****||  |                  | | || ^*****            | |  |  |     |  |    |  |   | |       ^*****  | |   |        ^***** |     |  ^*****||
search RasMol script viewer Motif-ligand binding stats  RGD ..   |  |          | |      ||||                  | |          ||| | |  |    |  |   |  ||  || |||        || || |  |       |  | |     |   |             || |||        | |   |  ||  | |                                       | |  | |   |         | |        || |  |  |  |  | |    | ||||| |         | |     | ***|      | |||| |  |   | || ||   ||||||      | |      |  |                           |       | |     | |  ||||| ||  | |||  |        |   | |  |  |       | |    | |      | | ||||  |        | |  | |             | | ||    |  |   |   | || ||||  |                  | | || ||||              | |  |  |     |  |    |  |   | |            |  | |   |        |  | | |     |   | |  ||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |          | |      ||||                  | |          ||| | |  |    |  |   *****  || |||        || || |  |       |  | |     |   |             || |||        | |   |  ||  | |                                       | |  | |   |         | |        || |  |  |  |  | |    | ||||| |         | |     | ||||      *****| |  |   | || ||   ||||||      | |      |  |                           |       | |     | |  |||*****  | |||  |        |   | |  |  |       | |    | |      | | ||||  |        | |  | |             | | ||    |  |   |   | || ||||  |                  | | || ||||              | |  |  |     |  |    |  |   | |            |  | |   |        |  | | |     |   | *****
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   |  |          | |      ||||                  | |          ||| | |  |    |  |   |  |   || |||        || || |  |       |  | |     |   |             || |||        | |   |  ||  | |                                       | |  | |   |         | |        || |  |  |  |  | |    | ||||| |         | |     | ||||      | || | |  |   | || ||   ||||||      | |      |  |                           |       | |     | |  ||||| ||  | |||  |        |   | |  |  |       | |    | |      | | ||||  |        | |  | |             | | ||    |  *****   | || ||||  |                  | | || ||||              | |  |  |     |  |    |  |   | |            |  | |   |        |  | | |     |   | |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  |          ***      ||||                  | |          *** | |  |    |  |   |  |   || |||        || || |  |       |  | |     |   |             || |||        | |   |  ||  ***                                       | |  | |   |         | |        || |  |  |  |  | |    | ||||| |         ***     | ||||      | || ***  |   | || ||   ||||||      | |      |  |                           |       | |     ***  ||||| ||  | |||  |        |   | |  |  |       | |    | |      | | ||||  |        | |  | |             | | ||    |  |       | || ||||  |                  | | || ||||              | |  |  |     |  |    |  |   | |            |  | |   |        |  | | |     |   | |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  |                   ||||                  | |           |  | ****    ****   ****   |****|        ****| |  |       |  | |     |   |             |****|        | |   |  ||  | |                                       | **** |   |         | |        ****  |  |  |  | |    | ****| |                 ****||      **** |    |   | *****   ||||||      | |      |  |                           |       | |     | |  |*****************        |   | |  |  |       | |    | |      | ****||  |        | |  | |             | | ||    |  |       | |****|****                  | | |****||              | |  |  |     ****    ****   | |            **** |   |        |  | | |     |   | **** 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   |  |                   ||||                  | |           |  | |  |                  |  | |         |  | |  |       |  | |     |   |             |  | |        | |   |  ||  | |                                       | |    |   |         | |        || |  |  |  |  | |    |  || | |                   ||||        |  |    |   | ||  |   ||||||      | |      |  |                           |       | |     | |  | |    |  | | |           |   | |  |  |       | |    | |      *** | ||  |        | |  | |             | | ||    |  |       | |  ||||                     | | |  | ||              | |  |  |                    ***                 |   |        |  | | |     |   |      
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |                   ****                  ***           |  | |  |                  |  ***         |  | |  |       |  | |     |   |             |  ***        | |   |  ||  | |                                       ***    |   |         ***        || |  |  |  |  ***    |  |*** |                   ****        |  |    |   ***|  |   ******      ***      |  |                           |       ***     | |  | |    |  | ***           |   ***  |  |       | |    | |          ***|  |        ***  | |             | | ||    |  |       ***  ****                     | | |  ***|              ***  |  |                                        |   |        |  | | |     |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..   ****                   | |                                 **** ****                  |    |         **** ****       ******     |   |             |    |        | |   **********                                              |   |                    ****  *******  |      ****  ***                               ****    |   |  ****                        ****                           |               ***  ***    ****               |   |    ****       ***    ***          *******             ***             | ****    ****            |***                     *****  ****                   ****                                        |   |        **** ***     |   |      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                          | |                                                            ******                                    |   |             ******        | |                                                           |   |                     |             |                                                      |   |                                                             |                                              |   |                                                                       |   |                     | |                                                                                                |   |                     |   |      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                          | |                                                                                                      *****                           | |                                                           *****                     |             |                                                      |   |                                                             |                                              |   |                                                                       |   |                     | |                                                                                                |   |                     |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                          | |                                                                                                                                      | |                                                                                     |             |                                                      *****                                                             |                                              *****                                                                       *****                     | |                                                                                                *****                     *****      
search RasMol script viewer Motif-ligand binding stats  stturn ..                          ***                                                                                                                                      | |                                                                                     |             |                                                                                                                        |                                                                                                                                                    ***                                                                                                                                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                   * *                                                                                     *             *                                                                                                                        *                                                                                                                                                                                                                                                                                            

   New search    1ps9:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors