triangle PDBeMotif: 1pdl  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.2.1.17
Classification hydrolase    | release date: Mon, May 19, 2003
Title fitting of gp5 in the cryoem reconstruction of the bacteriophage t4 baseplate
Authors F.ARISAKA, M.G.ROSSMANN, M.J.VAN, P.G.LEIMAN, P.R.CHIPMAN, RAAIJ, S.KANAMARU, V.A.KOSTYUCHENKO, V.V.MESYANZHINOV
Method ELECTRON MICROSCOPY (resolution: 12.00Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
MEMISNNLNWFVGVVEDRMDPLKLGRVRVRVVGLHPPQRAQGDVMGIPTEKLPWMSVIQPITSAAMSGIGGSVTGPVEGT
RVYGHFLDKWKTNGIVLGTYGGIVREKPNRLEGFSDPTGQYPRRLGNDTNVLNQGGEVGYDSSSNVIQDSNLDTAINPDD
RPLSEIPTDDNPNMSMAEMLRRDEGLRLKVYWDTEGYPTIGIGHLIMKQPVRDMAQINKVLSKQVGREITGNPGSITMEE
ATTLFERDLADMQRDIKSHSKVGPVWQAVNRSRQMALENMAFQMGVGGVAKFNTMLTAMLAGDWEKAYKAGRDSLWYQQT
KGRASRVTMIILTGNLESYGVEVKTPARSLSAMAATVAKSSDPADPPIPNDSRILFKEPVSSYKGEYPYVHTMETESGHI
QEFDDTPGQERYRLVHPTGTYEEVSPSGRRTRKTVDNLYDITNADGNFLVAGDKKTNVGGSEIYYNMDNRLHQIDGSNTI
FVRGDETKTVEGNGTILVKGNVTIIVEGNADITVKGDATTLVEGNQTNTVNGNLSWKVAGTVDWDVGGDWTEKMASMSSI
SSGQYTIDGSRIDIG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TAIL-ASSOCIATED LYSOZYME
member of: GENE3D:searchG3DSA_1.10.530.40PFAM:searchPF00959/searchPF06714/searchPF06715PFAMB:searchPB005613PRINTS:searchT4LYSOZYMESUPERFAMILY:searchSSF53955/searchSSF69255/searchSSF69349UniProt:searchP16009
sec str:  ......................................................................................................................................................................................................................................................................................................................................................... ........................................................................................................................................................................................................................
sequence :  ..NNLNWFVGVVEDRMDPLKLGRVRVRVVGLHPPQRAQGDVMGIPTEKLPWMSVIQPITSAAMSGIGGSVTGPVEGTRVYGHFLDKWKTNGIVLGTYGGIVREKPNRLEGFSDPTGQYPRRLGNDTNVLNQGGEVGYDSSSNVIQDSNLDTAINPDDRPLSEIPTDDNPNMSMAEMLRRDEGLRLKVYWDTEGYPTIGIGHLIMKQPVRDMAQINKVLSKQVGREITGNPGSITMEEATTLFERDLADMQRDIKSHSKVGPVWQAVNRSRQMALENMAFQMGVGGVAKFNTMLTAMLAGDWEKAYKAGRDSLWYQQTKGRASRVTMIILTGNLESYGVEVKT... ..DPADPPIPNDSRILFKEPVSSYKGEYPYVHTMETESGHIQEFDDTPGQERYRLVHPTGTYEEVSPSGRRTRKTVDNLYDITNADGNFLVAGDKKTNVGGSEIYYNMDNRLHQIDGSNTIFVRGDETKTVEGNGTILVKGNVTIIVEGNADITVKGDATTLVEGNQTNTVNGNLSWKVAGTVDWDVGGDWTEKMASMSSISSGQYTIDGSRIDIG
seq num:  ..6         16        26        36        46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       ... ..362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                                           | |                |    |                    |    |                          |^***|   |    |         |  |                   ^*** |          |       |                                 |    ||  |  |  |                       ^***                                   |       |                |    |      ..PS00001..        ^***        | |                                   |  |   | |||||     |  |  |                                     | |       ^***    ^***        | |    |  ||^***|   ^***|         |   |||                |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                                           ^**                |    |                    |    |                          |    |   |    |         |  |                     |  |          |       |                                 |    ||  |  |  |                                                              |       |                |    |      ..PS00005..                    ^**                                   |  |   ^**|^**     |  |  |                                     | |                           ^**    |  ||    |     ^**         |   ^**                |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                                                              |    |                    |    |                          |    |   |    |         ^***                     ^***          |       |                                 |    |^***  ^***                                                              |       |                |    |      ..PS00006..                                                          ^***   |  | |      |  ^***                                     | |                                  ^***|    |                 |    |                 ^***  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                                                              |    |                    |    |                          |    |   |    |                                                ********^                                 |    |                                                                        ********^                |    |      ..PS00007..                                                                 |  | *******^                                           | |                                      |    |                 |    |                       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                                                              ^*****                    ^*****                          ^*****   ^*****                                                                                          ^*****                                                                                                 ^*****      ..PS00008..                                                                 |  |                                                    | |                                      ^*****                 ^*****                       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                                                                                                                                                                                                                                                                                                                                                    ..PS00009..                                                                 ^***                                                    | |                                                                                          
search RasMol script viewer Motif-ligand binding stats  RGD ..                                                                                                                                                                                                                                                                                                                                                    ..PS00016..                                                                                                                         ***                                                                                          

chain B : TAIL-ASSOCIATED LYSOZYME
member of: GENE3D:searchG3DSA_1.10.530.40PFAM:searchPF00959/searchPF06714/searchPF06715PFAMB:searchPB005613PRINTS:searchT4LYSOZYMESUPERFAMILY:searchSSF53955/searchSSF69255/searchSSF69349UniProt:searchP16009
sec str:  ......................................................................................................................................................................................................................................................................................................................................................... ........................................................................................................................................................................................................................
sequence :  ..NNLNWFVGVVEDRMDPLKLGRVRVRVVGLHPPQRAQGDVMGIPTEKLPWMSVIQPITSAAMSGIGGSVTGPVEGTRVYGHFLDKWKTNGIVLGTYGGIVREKPNRLEGFSDPTGQYPRRLGNDTNVLNQGGEVGYDSSSNVIQDSNLDTAINPDDRPLSEIPTDDNPNMSMAEMLRRDEGLRLKVYWDTEGYPTIGIGHLIMKQPVRDMAQINKVLSKQVGREITGNPGSITMEEATTLFERDLADMQRDIKSHSKVGPVWQAVNRSRQMALENMAFQMGVGGVAKFNTMLTAMLAGDWEKAYKAGRDSLWYQQTKGRASRVTMIILTGNLESYGVEVKT... ..DPADPPIPNDSRILFKEPVSSYKGEYPYVHTMETESGHIQEFDDTPGQERYRLVHPTGTYEEVSPSGRRTRKTVDNLYDITNADGNFLVAGDKKTNVGGSEIYYNMDNRLHQIDGSNTIFVRGDETKTVEGNGTILVKGNVTIIVEGNADITVKGDATTLVEGNQTNTVNGNLSWKVAGTVDWDVGGDWTEKMASMSSISSGQYTIDGSRIDIG
seq num:  ..6         16        26        36        46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       ... ..362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                                           | |                |    |                    |    |                          |^***|   |    |         |  |                   ^*** |          |       |                                 |    ||  |  |  |                       ^***                                   |       |                |    |      ..PS00001..        ^***        | |                                   |  |   | |||||     |  |  |                                     | |       ^***    ^***        | |    |  ||^***|   ^***|         |   |||                |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                                           ^**                |    |                    |    |                          |    |   |    |         |  |                     |  |          |       |                                 |    ||  |  |  |                                                              |       |                |    |      ..PS00005..                    ^**                                   |  |   ^**|^**     |  |  |                                     | |                           ^**    |  ||    |     ^**         |   ^**                |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                                                              |    |                    |    |                          |    |   |    |         ^***                     ^***          |       |                                 |    |^***  ^***                                                              |       |                |    |      ..PS00006..                                                          ^***   |  | |      |  ^***                                     | |                                  ^***|    |                 |    |                 ^***  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                                                              |    |                    |    |                          |    |   |    |                                                ********^                                 |    |                                                                        ********^                |    |      ..PS00007..                                                                 |  | *******^                                           | |                                      |    |                 |    |                       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                                                              ^*****                    ^*****                          ^*****   ^*****                                                                                          ^*****                                                                                                 ^*****      ..PS00008..                                                                 |  |                                                    | |                                      ^*****                 ^*****                       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                                                                                                                                                                                                                                                                                                                                                    ..PS00009..                                                                 ^***                                                    | |                                                                                          
search RasMol script viewer Motif-ligand binding stats  RGD ..                                                                                                                                                                                                                                                                                                                                                    ..PS00016..                                                                                                                         ***                                                                                          

chain C : TAIL-ASSOCIATED LYSOZYME
member of: GENE3D:searchG3DSA_1.10.530.40PFAM:searchPF00959/searchPF06714/searchPF06715PFAMB:searchPB005613PRINTS:searchT4LYSOZYMESUPERFAMILY:searchSSF53955/searchSSF69255/searchSSF69349UniProt:searchP16009
sec str:  ......................................................................................................................................................................................................................................................................................................................................................... ........................................................................................................................................................................................................................
sequence :  ..NNLNWFVGVVEDRMDPLKLGRVRVRVVGLHPPQRAQGDVMGIPTEKLPWMSVIQPITSAAMSGIGGSVTGPVEGTRVYGHFLDKWKTNGIVLGTYGGIVREKPNRLEGFSDPTGQYPRRLGNDTNVLNQGGEVGYDSSSNVIQDSNLDTAINPDDRPLSEIPTDDNPNMSMAEMLRRDEGLRLKVYWDTEGYPTIGIGHLIMKQPVRDMAQINKVLSKQVGREITGNPGSITMEEATTLFERDLADMQRDIKSHSKVGPVWQAVNRSRQMALENMAFQMGVGGVAKFNTMLTAMLAGDWEKAYKAGRDSLWYQQTKGRASRVTMIILTGNLESYGVEVKT... ..DPADPPIPNDSRILFKEPVSSYKGEYPYVHTMETESGHIQEFDDTPGQERYRLVHPTGTYEEVSPSGRRTRKTVDNLYDITNADGNFLVAGDKKTNVGGSEIYYNMDNRLHQIDGSNTIFVRGDETKTVEGNGTILVKGNVTIIVEGNADITVKGDATTLVEGNQTNTVNGNLSWKVAGTVDWDVGGDWTEKMASMSSISSGQYTIDGSRIDIG
seq num:  ..6         16        26        36        46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       ... ..362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                                           | |                |    |                    |    |                          |^***|   |    |         |  |                   ^*** |          |       |                                 |    ||  |  |  |                       ^***                                   |       |                |    |      ..PS00001..        ^***        | |                                   |  |   | |||||     |  |  |                                     | |       ^***    ^***        | |    |  ||^***|   ^***|         |   |||                |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                                           ^**                |    |                    |    |                          |    |   |    |         |  |                     |  |          |       |                                 |    ||  |  |  |                                                              |       |                |    |      ..PS00005..                    ^**                                   |  |   ^**|^**     |  |  |                                     | |                           ^**    |  ||    |     ^**         |   ^**                |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                                                              |    |                    |    |                          |    |   |    |         ^***                     ^***          |       |                                 |    |^***  ^***                                                              |       |                |    |      ..PS00006..                                                          ^***   |  | |      |  ^***                                     | |                                  ^***|    |                 |    |                 ^***  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                                                              |    |                    |    |                          |    |   |    |                                                ********^                                 |    |                                                                        ********^                |    |      ..PS00007..                                                                 |  | *******^                                           | |                                      |    |                 |    |                       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                                                              ^*****                    ^*****                          ^*****   ^*****                                                                                          ^*****                                                                                                 ^*****      ..PS00008..                                                                 |  |                                                    | |                                      ^*****                 ^*****                       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                                                                                                                                                                                                                                                                                                                                                    ..PS00009..                                                                 ^***                                                    | |                                                                                          
search RasMol script viewer Motif-ligand binding stats  RGD ..                                                                                                                                                                                                                                                                                                                                                    ..PS00016..                                                                                                                         ***                                                                                          

   New search    1pdl:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML