triangle PDBeMotif: 1pdj  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification structural protein    | release date: Mon, May 19, 2003
Title fitting of gp27 into cryoem reconstruction of bacteriophage t4 baseplate
Authors F.ARISAKA, M.G.ROSSMANN, M.J.VAN, P.G.LEIMAN, P.R.CHIPMAN, RAAIJ, S.KANAMARU, V.A.KOSTYUCHENKO, V.V.MESYANZHINOV
Method ELECTRON MICROSCOPY (resolution: 12.00Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains D,E,F sequence:
MSMLQRPGYPNLSVKLFDSYDAWSNNRFVELAATITTLTMRDSLYGRNEGMLQFYDSKNIHTKMDGNEIIQISVANANDI
NNVKTRIYGCKHFSVSVDSKGDNIIAIELGTIHSIENLKFGRPFFPDAGESIKEMLGVIYQDRTLLTPAINAINAYVPDI
PWTSTFENYLSYVREVALAVGSDKFVFVWQDIMGVNMMDYDMMINQEPYPMIVGEPSLIGQFIQELKYPLAYDFVWLTKS
NPHKRDPMKNATIYAHSFLDSSIPMITTGKGENSIVVSRSGAYSEMTYRNGYEEAIRLQTMAQYDGYAKCSTIGNFNLTP
GVKIIFNDSKNQFKTEFYVDEVIHELSNNNSVTHLYMFTNATKLETIDPVKVKNEFKSDTTTEESSSSNKQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : BASEPLATE STRUCTURAL PROTEIN GP27
member of: GENE3D:searchG3DSA_2.40.10.10PFAM:searchPF09096/searchPF09097SUPERFAMILY:searchSSF69279UniProt:searchP17172
sec str:  ........................................................................................................................................................................................................................... ........................................................................................................................................................
sequence :  ..LQRPGYPNLSVKLFDSYDAWSNNRFVELAATITTLTMRDSLYGRNEGMLQFYDSKNIHTKMDGNEIIQISVANANDINNVKTRIYGCKHFSVSVDSKGDNIIAIELGTIHSIENLKFGRPFFPDAGESIKEMLGVIYQDRTLLTPAINAINAYVPDIPWTSTFENYLSYVREVALAVGSDKFVFVWQDIMGVNMMDYDMMINQEPYPMIVGEPS... ..KYPLAYDFVWLTKSNPHKRDPMKNATIYAHSFLDSSIPMITTGKGENSIVVSRSGAYSEMTYRNGYEEAIRLQTMAQYDGYAKCSTIGNFNLTPGVKIIFNDSKNQFKTEFYVDEVIHELSNNNSVTHLYMFTNATKLETIDPVKVKNEF
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214 ... ..227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       ^***|                       | ||                   |  |                                 |  |       |    |               | ||                             |  |              | |             |                   ..PS00001..                       ^***   |  |       | |                | |                                     ^***                  ^***       ^*** |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         ^**                       ^**|                   |  |                                 |  |       |    |               ^**|                             |  |              ^**             |                   ..PS00005..                              |  |       ^**                ^**                                                                        |  |           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                                   ^***                   ^***                                 ^***       |    |               ^***                             ^***                |             |                   ..PS00006..                              ^***                                                                                                     ^***           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                                                                                                          ^*****                                                                    |             |                   ..PS00008..                                                                                                                                                      
search RasMol script viewer Motif-ligand binding stats  HMG_COA_REDUCTASE_1 ..                                                                                                                                                                                    ***************                   ..PS00066..                                                                                                                                                      

chain E : BASEPLATE STRUCTURAL PROTEIN GP27
member of: GENE3D:searchG3DSA_2.40.10.10PFAM:searchPF09096/searchPF09097SUPERFAMILY:searchSSF69279UniProt:searchP17172
sec str:  ........................................................................................................................................................................................................................... ........................................................................................................................................................
sequence :  ..LQRPGYPNLSVKLFDSYDAWSNNRFVELAATITTLTMRDSLYGRNEGMLQFYDSKNIHTKMDGNEIIQISVANANDINNVKTRIYGCKHFSVSVDSKGDNIIAIELGTIHSIENLKFGRPFFPDAGESIKEMLGVIYQDRTLLTPAINAINAYVPDIPWTSTFENYLSYVREVALAVGSDKFVFVWQDIMGVNMMDYDMMINQEPYPMIVGEPS... ..KYPLAYDFVWLTKSNPHKRDPMKNATIYAHSFLDSSIPMITTGKGENSIVVSRSGAYSEMTYRNGYEEAIRLQTMAQYDGYAKCSTIGNFNLTPGVKIIFNDSKNQFKTEFYVDEVIHELSNNNSVTHLYMFTNATKLETIDPVKVKNEF
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214 ... ..227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       ^***|                       | ||                   |  |                                 |  |       |    |               | ||                             |  |              | |             |                   ..PS00001..                       ^***   |  |       | |                | |                                     ^***                  ^***       ^*** |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         ^**                       ^**|                   |  |                                 |  |       |    |               ^**|                             |  |              ^**             |                   ..PS00005..                              |  |       ^**                ^**                                                                        |  |           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                                   ^***                   ^***                                 ^***       |    |               ^***                             ^***                |             |                   ..PS00006..                              ^***                                                                                                     ^***           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                                                                                                          ^*****                                                                    |             |                   ..PS00008..                                                                                                                                                      
search RasMol script viewer Motif-ligand binding stats  HMG_COA_REDUCTASE_1 ..                                                                                                                                                                                    ***************                   ..PS00066..                                                                                                                                                      

chain F : BASEPLATE STRUCTURAL PROTEIN GP27
member of: GENE3D:searchG3DSA_2.40.10.10PFAM:searchPF09096/searchPF09097SUPERFAMILY:searchSSF69279UniProt:searchP17172
sec str:  ........................................................................................................................................................................................................................... ........................................................................................................................................................
sequence :  ..LQRPGYPNLSVKLFDSYDAWSNNRFVELAATITTLTMRDSLYGRNEGMLQFYDSKNIHTKMDGNEIIQISVANANDINNVKTRIYGCKHFSVSVDSKGDNIIAIELGTIHSIENLKFGRPFFPDAGESIKEMLGVIYQDRTLLTPAINAINAYVPDIPWTSTFENYLSYVREVALAVGSDKFVFVWQDIMGVNMMDYDMMINQEPYPMIVGEPS... ..KYPLAYDFVWLTKSNPHKRDPMKNATIYAHSFLDSSIPMITTGKGENSIVVSRSGAYSEMTYRNGYEEAIRLQTMAQYDGYAKCSTIGNFNLTPGVKIIFNDSKNQFKTEFYVDEVIHELSNNNSVTHLYMFTNATKLETIDPVKVKNEF
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214 ... ..227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       ^***|                       | ||                   |  |                                 |  |       |    |               | ||                             |  |              | |             |                   ..PS00001..                       ^***   |  |       | |                | |                                     ^***                  ^***       ^*** |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         ^**                       ^**|                   |  |                                 |  |       |    |               ^**|                             |  |              ^**             |                   ..PS00005..                              |  |       ^**                ^**                                                                        |  |           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                                   ^***                   ^***                                 ^***       |    |               ^***                             ^***                |             |                   ..PS00006..                              ^***                                                                                                     ^***           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                                                                                                          ^*****                                                                    |             |                   ..PS00008..                                                                                                                                                      
search RasMol script viewer Motif-ligand binding stats  HMG_COA_REDUCTASE_1 ..                                                                                                                                                                                    ***************                   ..PS00066..                                                                                                                                                      

   New search    1pdj:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML