triangle PDBeMotif: 1oo3  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification protein binding    | release date: Mon, Mar 3, 2003
Title p395s mutant of the p85 regulatory subunit of the n- terminal src homology 2 domain of pi3-kinase
Authors B.SCHAFFHAUSEN, B.WEYRAUCH, U.L.GUENTHER
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKSIKIFHRDGKYGFSDSLTFNS
VVELINHYRNESLAQYNPKLDVKLLYPVSKY
Residue colours:  hydrophilic   hydrophobic   intermediate 
    View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY ALPHASUBUNIT;
member of: CATH:search3.30.505.10GENE3D:searchG3DSA_3.30.505.10PANTHER:searchPTHR10155/searchPTHR10155_SF3PFAM:searchPF00017PFAMB:searchPB014608PRINTS:searchPI3KINASEP85/searchSH2DOMAINPROSITE PROFILES:searchPS50001, SMART:searchSM00252SUPERFAMILY:searchSSF55550UniProt:searchP23727
sec str:  .........................hhhhhhh...eeee............eeee......................................hhhhh...............
sequence :  ..GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKSIKIFHRDGKYGFSDSLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKY
seq num:  ..1         11        21        31        41        51        61        71        81        91        101        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| ||^***||| | | | | ||   |  ||       | || | ||||| | |  | ^***|  ||||   | |     |  |   | |^***|            | | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| ||||| ||| | | | | ||   |  ||       | |^** ||||| ^**  |   ^**  ||||   | |     |  |   | |  | |            | | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| ||||^***| | | | ^***   |  ||       | |    |||||      |   |||  ||||   | |     ^***   | |  | |            | | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****  | | | | | | |    |  ||       | |    |||||      ^*****|  ||||   | |            | |  | |            | | |
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..| ||||  | | | | | | |    |  ||       | |    |||||          | |  ||||   | |            | |  | |            | ***
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| ||||  | | | | | | |    *****       | |    |||||          | |  ||||   | |            | |  | |            | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..| ||||  | | | | | | |    ****        | |    |||||          | |  ||||   | |            | |  | |            | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..******  | | *** | ***                ***    ****|          | |  |***   ***            ***  | |            ***  
search RasMol script viewer Motif-ligand binding stats  nest ..        ***   ***                            |  |          | |  ***                        | |                 
search RasMol script viewer Motif-ligand binding stats  niche ..                                             ****          ***                             | |                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                           ***                 

   New search    1oo3:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML