triangle PDBeMotif: 1o47  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.1.112
Classification signaling protein    | release date: Sun, Jun 15, 2003
Title crystal structure of sh2 in complex with ru82209.
Authors A.LIESUM, G.LANGE, P.LOENZE
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search 822 822 binding statistics 822
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFN
SLQQLVAYYSKHADGLCHRLTTVCPTSK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
member of: CATH:search3.30.505.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF53PFAM:searchPF00017PRINTS:searchSH2DOMAINPROSITE PROFILES:searchPS50001/searchPS50002, SMART:searchSM00252SUPERFAMILY:searchSSF50044/searchSSF55550UniProt:searchP12931
JMol viewer RasMol script viewer  822 300A  ..             *                   * **      *               ***          **                   ***          
sec str:  ..hhhhh..eee..hhhhhhhhhh........eeeee.......eeeeeeeee...eeeeeeeeeee.....ee.....ee.hhhhhhhhhhhh..............
sequence :  ..SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT
seq num:  ..1         11        21        31        41        51        61        71        81        91        101   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  |  |    |**^* |   | |||  |     | ||| |   |  | |   |          | |||   | ||   |   |   |  ||| |         |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |  |    ^**|^**   | |||  |     | ^** |   |  | |   |          | |||   ^**|   |   |   |  ||| |         ^
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  |  |    ^***|     | |||  |     |  |  |   ^*** |   |          | |||   |  |   |   |   |  ||| |          
search RasMol script viewer Motif-ligand binding stats  asxmotif .. |  |  |    |   |     *****  |     |  |  |        *****          | |||   |  |   |   |   |  ||| |          
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |  |    |   |     ***||  |     |  |  |                       | |||   |  |   |   |   |  ||| |          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. |  |  |    |   |     |  ||  |     |  |  |                       *****   |  |   |   |   |  ||| |          
search RasMol script viewer Motif-ligand binding stats  betaturn .. *******    |   |     ********     |  ****                       ****|   |  |   |   |   |  |****          
search RasMol script viewer Motif-ligand binding stats  nest .. |  |  |    |   |     |  ||  |     |  |  |                         ***   |  |   |   |   |  | | |          
search RasMol script viewer Motif-ligand binding stats  niche .. *******    |   |     ********     *******                               ****   |   |   **** ***          
search RasMol script viewer Motif-ligand binding stats  stmotif ..            *****                                                               *****                     

   New search    1o47:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML