triangle PDBeMotif: 1nlo  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.1.112
Classification complex (transferase/peptide)    | release date: Sun, Aug 4, 1996
Title structure of signal transduction protein, nmr, minimized average structure
Authors A.P.COMBS, F.SHIRAI, S.FENG, S.L.SCHREIBER, T.M.KAPOOR
Method SOLUTION NMR
PDBe Citation   
Small molecules:    search ACE ACE binding statistics ACE   search MN7 MN7 binding statistics MN7   search MN2 MN2 binding statistics MN2   search MN1 MN1 binding statistics MN1
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain C sequence:
GSHMGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Chain N sequence:
PLPPLPX
Residue colours:  hydrophilic   hydrophobic   intermediate 
    View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : C-SRC
member of: CATH:search2.30.30.40GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR24418/searchPTHR24418_SF53PFAM:searchPF00018PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044/searchSSF55550UniProt:searchP00523
JMol viewer RasMol script viewer  MN1 74N  ..                                 *                      
JMol viewer RasMol script viewer  MN2 73N  ..             **                  *            *         
JMol viewer RasMol script viewer  MN7 72N  ..          ** **                  *            |         
JMol viewer RasMol script viewer  ACE 71N  ..          || ||                  |            |         
sec str:  ...eee....................eeee.....eeeee......eeeeehhheee.
sequence :  ..TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
seq num:  ..9         19        29        39        49        59    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         | || | | |  |     ^*** |        | |    || ||   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | || | ^**  |       |  |        | |    || ||   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         ^*** |   |  |       ^***        | |    || ||   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  |   |  |                   | |    || ||   
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |  |   |  |                   | |    ****|   
search RasMol script viewer Motif-ligand binding stats  nest ..           |  |   |  |                   ***     |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..           ****   ****                           ****   

chain N : NL1 (MN7-MN2-MN1-PLPPLP)
JMol viewer RasMol script viewer  MN1 74N  ..**     
JMol viewer RasMol script viewer  MN7 72N  ..||     
sec str:  ....eee..
sequence :  ..PLPPLPX
seq num:  ..75     

   New search    1nlo:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML