triangle PDBeMotif: 1neg  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification structural protein    | release date: Wed, Dec 11, 2002
Title crystal structure analysis of n-and c-terminal labeled sh3- domain of alpha-chicken spectrin
Authors A.DIEHL, F.H.NIESEN, K.BUESSOW, L.NYARSIK, U.HEINEMANN, U.MUELLER
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search AZI AZI binding statistics AZI
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MRGSHHHHHHGSDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLAAAWSHPQ
FEK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SPECTRIN ALPHA CHAIN, BRAIN
member of: GENE3D:searchG3DSA_1.20.58.60/searchG3DSA_2.30.30.40PANTHER:searchPTHR11915/searchPTHR11915_SF69PFAM:searchPF00018/searchPF00435PFAMB:searchPB009853PRINTS:searchSH3DOMAIN/searchSPECTRNALPHAPROSITE PROFILES:searchPS50002, SMART:searchSM00150/searchSM00326SUPERFAMILY:searchSSF46966/searchSSF50044UniProt:searchP07751
JMol viewer RasMol script viewer  AZI 201A  ..                                                     **          
sec str:  ....eeee..................eeeeee.....eeeeee..eeeeee...eee..........
sequence :  ..KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLAAAWSHPQF
seq num:  ..6         16        26        36        46        56        66   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..||           | || | |  |    |^***|||    |  |     |  |   |  |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*|           ^**| ^**  |    |||^**||    |  |     |  |   |  |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..**           ^***   |  |    |||^***|    |  |     |  |   |  |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             |  |   |  |    |||||  |    |  |     |  |   |  |     
search RasMol script viewer Motif-ligand binding stats  asxturn ..             |  |   |  |    |***|  |    |  |     |  |   |  |     
search RasMol script viewer Motif-ligand binding stats  betabulge ..             |  |   |  |    **| |  |    |  |     |  |   |  |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..             |  |   ****      | |  |    ****     |  |   |  |     
search RasMol script viewer Motif-ligand binding stats  niche ..             ****   ****      ******             ****   ****     

   New search    1neg:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors