triangle PDBeMotif: 1n0w  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Download structure factors file
Classification gene regulation/antitumor protein    | release date: Tue, Oct 15, 2002
Title crystal structure of a rad51-brca2 brc repeat complex
Authors A.R.VENKITARAMAN, D.S.YU, L.PELLEGRINI, M.LEE, S.ANAND, T.L.BLUNDELL, T.LO
Method X-RAY DIFFRACTION (resolution: 1.70Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search CL CL binding statistics CL   search EDO EDO binding statistics EDO
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAE
RYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLA
DEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGD
AKD
Chain B sequence:
KEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQ
Chain L sequence:
TGSTGSTGSTGSMG
Chain C sequence:
GSMG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DNA REPAIR PROTEIN RAD51 HOMOLOG 1
JMol viewer RasMol script viewer  EDO 506A  ..                               *     *                             *    *                                                           ..                               ..EDO ..                                               
JMol viewer RasMol script viewer  EDO 505A  ..                               |     |                          ** |    |                                                       **  ..                               ..EDO ..                                               
JMol viewer RasMol script viewer  EDO 504A  ..                               |     |                          || |    |                                                       ||  ..                               ..EDO ..                  *            * *             
JMol viewer RasMol script viewer  EDO 503A  ..                          *    |     |                          || |    |                                                       ||  ..            *                  ..EDO ..*     *           |            | |             
JMol viewer RasMol script viewer  EDO 502A  ..                          |    |     |                  *       || |    |                                                       ||  ..            |                  ..EDO ..|     |           |            | |             
JMol viewer RasMol script viewer  CL 501A  ..                          |    ** ****                  |       || |    |                                                       ||  ..            |                  ..CL ..|     |           |            | |             
JMol viewer RasMol script viewer  MG 401A  ..   *           *          |    || ||||                  |       || |    |                                                       ||  ..            |                  ..MG ..|     |           |            | |             
sec str:  .....ee...hhhhhhhh...ee...eeeee.....hhhhhhhhhhhhhhhhhhhh....eeeeee.....hhhhhhhhhhhh..hhhhhhhheeeee..hhhhhhhhhhhhhhhhhhh.eeeeeee..hhhhh..hhhhhhhhhhhhhhhhhhhhhhhh.eeeeee... .......eeeeeee....eeeeee........eeeeeeee..eee....
sequence :  ..EIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYR..ELSARQMHLARFLRMLLRLADEFGVAVVITN... ..AHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
seq num:  ..98        108       118       128       138       148       158       168       178       188       198       208       218         ..237       247       257        ... ..293       303       313       323       333    
search RasMol script viewer Motif-ligand binding stats  PS00005 ..     ||||    | |||  | ||  |  || |^**|    |  || |||| |||| ||      ||^**       || ||||  |||  |      | |            |  |          |  | ..  ^**                 | |      ..PS00005.. |  ^**      || |       |  |            |    | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..     ||||    | |||  | |^***  || |||||    |  || |||| |||| ||      ||||        || |||^***||  |      | |            |  |          |  | ..                      | |      ..PS00006.. |  |        || |       |  |            |    | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..     ||||    | ||^*****|     || |||||    |  || |||| |^*****      ||||        || |^*****||  |      | |            |  |          |  | ..                      | |      ..PS00008..**  |        || |       |  |            ^***** 
search RasMol script viewer Motif-ligand binding stats  PS00017 ..     ||||    | |||  |  |     ********    |  || |||| |||| |       ||||        || ||||   ||  |      | |            |  |          |  | ..                      | |      ..PS00017.. |  |        || |       |  |                   
search RasMol script viewer Motif-ligand binding stats  asxturn ..     ||||    | |||  |  |      | |||||    |  || |||| |||| |       ||||        || ||||   ||  |      ***            |  |          |  | ..                      | |      ..asxturn.. |  |        || |       |  |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ||||    ****|  |  |      ****|||    |  ****|*****|| |       ||||        |****||   ||  |                     |  |          **** ..                      | |      ..betaturn.. ****        ****       ****                   
search RasMol script viewer Motif-ligand binding stats  nest ..     |***      ***  |  |        *****    |   |  ||  ******       ****        |  ***|   ||  |                     |  |               ..                      ***      ..nest.. |  |         | |       |  |                   
search RasMol script viewer Motif-ligand binding stats  niche ..     ||||           ****                 |   ****|    |           ***        |    ||   |****                     ****               ..                               ..niche.. ****         ***       ****                   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..     ||||                                |   |   ******                      ******|   |                                            ..                               ..schellmannloop..                                               
search RasMol script viewer Motif-ligand binding stats  stmotif ..     ||||                                |   |                                     *****                                            ..                               ..stmotif..                                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..     ||||                                *****                                                                                      ..                               ..ststaple..                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..     ****                                                                                                                           ..                               ..stturn..                                               

chain B : BREAST CANCER TYPE 2 SUSCEPTIBILITY PROTEIN
sec str:  ..hhhhh.ee........hhhhhhhh.........
sequence :  ..PTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQ
seq num:  ..1519      1529      1539         
search RasMol script viewer Motif-ligand binding stats  PS00005 ..       | ^**|          | || |    
search RasMol script viewer Motif-ligand binding stats  PS00009 ..       | ^***          | || |    
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..       *****           | || |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|           **** |    
search RasMol script viewer Motif-ligand binding stats  nest ..         ***             |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                         ****    

chain L : PEPTIDE LINKER
sec str:  .....
sequence :  ..TGS
seq num:  ..1  
search RasMol script viewer Motif-ligand binding stats  PS00008 .. ^*

chain C : ARTIFICIAL GLY-SER-MSE-GLY PEPTIDE
sec str:  ......
sequence :  ..GSMG
seq num:  ..1   

   New search    1n0w:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML  |  Structure factors