triangle PDBeMotif: 1mg5  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   1.1.1.1
Classification oxidoreductase    | release date: Wed, Aug 14, 2002
Title crystal structure of drosophila melanogaster alcohol dehydro complexed with nadh and acetate at 1.6 a
Authors J.BENACH, R.GONZALEZ-DUARTE, R.LADENSTEIN, S.ATRIAN
Method X-RAY DIFFRACTION (resolution: 1.63Å)
PDBe Citation   
Small molecules:    search ACT ACT binding statistics ACT   search NAI NAI binding statistics NAI
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
SFTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVTFYPYDVTVPIAETTKLLKTIF
AQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILDFWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVV
NFTSSLAKLAPITGVTAYTVNPGITRTTLVHKFNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDLG
TLEAIQWTKHWDSGI
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALCOHOL DEHYDROGENASE
member of: GENE3D:searchG3DSA_3.40.50.720PANTHER:searchPTHR24316/searchPTHR24316_SF28PFAM:searchPF00106PRINTS:searchALCDHDRGNASE/searchINSADHFAMILY/searchSDRFAMILYPROSITE PATTERNS:searchPS00061, SUPERFAMILY:searchSSF51735UniProt:searchP00334
JMol viewer RasMol script viewer  ACT 901B  ..                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  NAI 850A  ..            *  ***                   ***                      ***                          ***        *   *                             ***            *   *                         **** * *                                                                  
JMol viewer RasMol script viewer  ACT 900A  ..            |  |||                   |||                      |||                          |||        |   |                             ||* *          *   |                         ||*| | |                                                                  
sec str:  .........eeeee...hhhhhhhhhhhh.....eeeeee...hhhhhhhhhhhh...eeeeee.....hhhhhhhhhhhhhhhhh...eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeee.hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhheeeeeeee..ee........hhhhh..hhhhhhhh...eehhhhhhhhhhhhhhh....eeeee..eeee...........
sequence :  ..SFTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVTFYPYDVTVPIAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILDFWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLVHKFNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDLGTLEAIQWTKHWDSGI
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  ||| |     | |  ||  | |||  |        | | |   |      | ||       | ||    | |   |            | |   | |     |  ^***  ^***   |  ||||||   |    |||  ||       | | |  | ^***  |     | |       |   |||  |  |  | |      |  |                 | |  |      |    |       | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  ||^**     | |  ||  ^**||  |        | | |   |      | ||       | ||    ^**   |            | |   | |     |  | ||    |    |  ||||||   |    |||  ||       | | |  |       |     | |       |   |||  |  |  | |      |  |                 | |  |      |    |       | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ||| |     | |  ||  ^***|  |        | | |   |      | ||       | ||      |   |            | |   | |     |  | ||    |    |  ||||||   |    |||  ||       | | |  |       |     | |       |   |||  |  ^*** |      |  |                 | |  |      |    |       | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ||| |     | |  |^***** |  |        | | |   |      | ||       | ||      |   |            | |   | |     |  | |^*****    |  ||||^*****    ^*****|       | ^*****       |     | |       ^*****|  |     | |      |  |                 | |  |      ^*****       | |
search RasMol script viewer Motif-ligand binding stats  ADH_SHORT ..  ||| |     | |  |   |   |  |        | | |   |      | ||       | ||      |   |            | |   | |     |  | |          |  ||||||         *************^***************     | |           | |  |     | |      |  |                 | |  |                   | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  ||| |     | |  |   |   |  |        | | |   |      | ||       | ||      |   |            | |   | |     |  | |          |  ||||||         |*****       |   |                | |           | |  |     | |      |  |                 | |  |                   | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  ||| |     | |  |   |   |  |        | | *****      | ||       | ||      |   |            | |   | |     |  | |          |  *****|         ||  |        |   |                | |           | |  |     | |      |  |                 | |  |                   | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ||| |     | |  |   |   |  |        | |            ***|       ***|      |   |            | |   ***     |  | |          |  ***|||         ||  |        |   |                | |           | |  |     | |      |  |                 | |  |                   | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ||| |     | |  |   |   |  |        | |            |  |       |  |      |   |            | |           |  | |          |  *****|         |****        |   |                | |           | |  |     | |      |  |                 | |  |                   | |
search RasMol script viewer Motif-ligand binding stats  nest ..  ||| |     ***  |   |   |  |        | |            |  |       |  |      |   |            | |           |  | |          |  |  ***         |            |   |                ***           | |  |     ***      |  |                 ***  |                   ***
search RasMol script viewer Motif-ligand binding stats  niche ..  *****          |   |   ****        ***            ****       ****      |   |            ***           |  | |          ****    |         |            |   |                | |           | ****              ****                   ****                   | |
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                 |   |                                                   |   |                          |  | |             ******         |            |   |                | |           | |                                                               | |
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                                   *****                          ******                            |            |   |                | |           | |                                                               | |
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                           |                              |            |   |                ***           ***                                                               ***
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                           *                              *            *   *                                                                                                   

chain B : ALCOHOL DEHYDROGENASE
member of: GENE3D:searchG3DSA_3.40.50.720PANTHER:searchPTHR24316/searchPTHR24316_SF28PFAM:searchPF00106PRINTS:searchALCDHDRGNASE/searchINSADHFAMILY/searchSDRFAMILYPROSITE PATTERNS:searchPS00061, SUPERFAMILY:searchSSF51735UniProt:searchP00334
JMol viewer RasMol script viewer  NAI 851B  ..            *  ***                   ***                      ***                          ****       *   *                             ***            *   *                         **** * *                                                                  
JMol viewer RasMol script viewer  ACT 901B  ..            |  |||                   |||                      |||                          ||||       |   |                             ||* *    *     *   |                         ||*| | |                                                                  
JMol viewer RasMol script viewer  ACT 900A  ..            |  |||                   |||                      |||                          ||||       |   |                             ||| |    |     |   |                         |||| | |                                                                  
sec str:  .........eeeee...hhhhhhhhhhhh.....eeeeee...hhhhhhhhhhhh...eeeeee.....hhhhhhhhhhhhhhhhh...eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeee.hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhheeeeeeee..eehhhhhh..hhhhh..hhhhhhhh...eehhhhhhhhhhhhhhh....eeeee..eeee...........
sequence :  ..SFTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVTFYPYDVTVPIAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILDFWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLVHKFNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDLGTLEAIQWTKHWDSGI
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  ||| |     | |  ||  | |||  |        | | | | |      | ||       | ||    | |                | |   | |||   |  ^*** |^*** | ||||| |||   |    ||| |||       | | |  | ^***  |     | |       |   |||  |  |  | |      |  |                 | |  |      |    |      ||||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  ||^**     | |  ||  ^**||  |        | | | | |      | ||       | ||    ^**                | |   | |||   |  | || |  || | ||||| |||   |    ||| |||       | | |  |   |   |     | |       |   |||  |  |  | |      |  |                 | |  |      |    |      ||||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ||| |     | |  ||  ^***|  |        | | | | |      | ||       | ||                       | |   | |||   |  | || |  || | ||||| |||   |    ||| |||       | | |  |   |   |     | |       |   |||  |  ^*** |      |  |                 | |  |      |    |      ||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ||| |     | |  |^***** |  |        | | | | |      | ||       | ||                       | |   | |||   |  | |^*****| | ||||| |^*****    ^*****|       | ^*****   |   |     | |       ^*****|  |     | |      |  |                 | |  |      ^*****      ||||
search RasMol script viewer Motif-ligand binding stats  ADH_SHORT ..  ||| |     | |  |   |   |  |        | | | | |      | ||       | ||                       | |   | |||   |  | |  |   | | ||||| |||         *************^***************     | |           | |  |     | |      |  |                 | |  |                  ||||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  ||| |     | |  |   |   |  |        | | | | |      | ||       | ||                       | |   | |||   |  | |  |   | *****|| |||         |*****       |   |  |   |         | |           | |  |     | |      |  |                 | |  |                  ||||
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  ||| |     | |  |   |   |  |        | | *****      | ||       | ||                       | |   *****   |  | |  |   | | || || |||         || ||        |   |  |   |         | |           | |  |     | |      |  |                 | |  |                  ||||
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ||| |     | |  |   |   |  |        | | ***        ***|       ***|                       | |   ***|    |  | |  |   | | || || |||         || ||        |   |  |   |         | |           | |  |     | |      |  |                 | |  |                  ***|
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ||| |     | |  |   |   |  |        | |            |  |       |  |                       | |   ****    |  | |  |   | **** |****|         *****        |   |  |   |         | |           | |  |     | |      |  |                 | ****                   | |
search RasMol script viewer Motif-ligand binding stats  nest ..  ||| |     ***  |   |   |  |        | |            |  |       |  |                       | |           |  | |  |   |   |  |  ***         |            |   |  |   |         ***           | |  |     ***      |  |                 ***  |                   ***
search RasMol script viewer Motif-ligand binding stats  niche ..  *****          |   |   ****        ***            ****       ****                       ***           |  | |  |   |   ****    |         |            |   |  |   |         | |           | ****              ****                   ****                   | |
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                 |   |                                                                                  |  | |  |   |      ******         |            |   |  |   |         | |           | |                                                               | |
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 *****                                                                                  ******  *****                     |            |   |  *****         | |           | |                                                               | |
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                           |                              |            |   |                ***           ***                                                               ***
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                           *                              *            *   *                                                                                                   

   New search    1mg5:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML