triangle PDBeMotif: 1l1l  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   1.17.4.2
Classification oxidoreductase    | release date: Mon, Feb 18, 2002
Title crystal structure of b-12 dependent (class ii) ribonucleotide reductase
Authors B.A.KELLOGG, C.L.DRENNAN, G.ARJARA, J.STUBBE, M.D.SINTCHAK
Method X-RAY DIFFRACTION (resolution: 1.75Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
MSEEISLSAEFIDRVKASVKPHWGKLGWVTYKRTYARWLPEKGRSENWDETVKRVVEGNINLDPRLQDSPSLELKQSLTE
EAERLYKLIYGLGATPSGRNLWISGTDYQRRTGDSLNNCWFVAIRPQKYGDSKIVPSYLGKQEKAVSMPFSFLFDELMKG
GGVGFSVARSNISQIPRVDFAIDLQLVVDETSESYDASVKVGAVGKNELVQDADSIYYRLPDTREGWVLANALLIDLHFA
QTNPDRKQKLILDLSDIRPYGAEIHGFGGTASGPMPLISMLLDVNEVLNNKAGGRLTAVDAADICNLIGKAVVAGNVRRS
AELALGSNDDQDFISMKQDQEKLMHHRWASNNSVAVDSAFSGYQPIAAGIRENGEPGIVNLDLSKNYGRIVDGYQAGIDG
DVEGTNPCGEISLANGEPCNLFEVFPLIAEEQGWDLQEVFALAARYAKRVTFSPYDWEISREIIQKNRRIGISMSGIQDW
LLTRLGNRVVTGFKDDFDPETHEAIKVPVYDKRAIKMVDQLYKAVVKADQDYSKTLGCNESIKHTTVKPSGTVAKLAGAS
EGMHFHYGAYLIQRIRFQDSDPLLPALKACGYRTEADIYTENTTCVEFPIKAVGADNPNFASAGTVSIAEQFATQAFLQT
YWSDNAVSCTITFQDSEGDQVESLLRQYRFITKSTSLLPYFGGSLQQAPKEPIDKETYEKRSQEITGNVEEVFSQLNSDV
KDLELVDQTDCEGGACPIK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RIBONUCLEOSIDE TRIPHOSPHATE REDUCTASE
member of: CATH:search3.20.70.20/search3.30.1620.10/search3.90.1390.10GENE3D:searchG3DSA_3.20.70.20/searchG3DSA_3.90.1390.10PFAM:searchPF02867SUPERFAMILY:searchSSF51998TIGRFAMS:searchTIGR02505UniProt:searchQ59490
sec str:  ......hhhhhhhhhhhh......hhhhhhhh....ee....ee.hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..eeehhhhhhhh.hhhhhh.......eeeee...ee...............ee.hhhhhhhhhhhhh..eeeee.hhhhhh.........eeeee......hhhhhhhh..............eeee...hhhhhhhhhhhhhhhhhhhhh.....eeeee....................hhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh..... ...eeeeee..hhhhhhh..hhhhhhhh...eeeeeee.....hhhhhhhhhhhhh..eeeehhhhhhh.hhhhh........eeee......eee......eeeehhhhhhhh..hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh..eeee.hhhhhhhhhhh...eeeeeeee......eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhh.......ee...hhhhhhhhh...........eeeeeeeee...hhhhhhhhh..eeee......eeeeeeeee...............hhhhhhhhhhhhhhhh.......eeeehhhhhhhhhhhhhhh.....eeeeee..........eee.hhhhhhhhhhhh..hhhhhhhhhhhhh....
sequence :  ..EISLSAEFIDRVKASVKPHWGKLGWVTYKRTYARWLPEKGRSENWDETVKRVVEGNINLDPRLQDSPSLELKQSLTEEAERLYKLIYGLGATPSGRNLWISGTDYQRRTGDSLNNCWFVAIRPQKYGDSKIVPSYLGKQEKAVSMPFSFLFDELMKGGGVGFSVARSNISQIPRVDFAIDLQLVVDETSESYDASVKVGAVGKNELVQDADSIYYRLPDTREGWVLANALLIDLHFAQTNPDRKQKLILDLSDIRPYGAEIHGFGGTASGPMPLISMLLDVNEVLNNKAGGRLTAVDAADICNLIGKAVVAGN... ..AELALGSNDDQDFISMKQDQEKLMHHRWASNNSVAVDSAFSGYQPIAAGIRENGEPGIVNLDLSKNYGRIVDGYQAGIDGDVEGTNPCGEISLANGEPCNLFEVFPLIAEEQGWDLQEVFALAARYAKRVTFSPYDWEISREIIQKNRRIGISMSGIQDWLLTRLGNRVVTGFKDDFDPETHEAIKVPVYDKRAIKMVDQLYKAVVKADQDYSKTLGCNESIKHTTVKPSGTVAKLAGASEGMHFHYGAYLIQRIRFQDSDPLLPALKACGYRTEADIYTENTTCVEFPIKAVGADNPNFASAGTVSIAEQFATQAFLQTYWSDNAVSCTITFQDSEGDQVESLLRQYRFITKSTSLLPYFGGSLQQAPKEPIDKETYEKRSQEITGNVEEVFSQLNSDVKDLE
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304          ... ..321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          | | |||   |  |  | | | |     | |      | |      |  | |  |  |   | |  |        | ||||  ||| | || || || | | ||              | | |  ||  |   |   |       |||   || |  ^***|             |  | |   ||||||  |  |  | ||     | |   |        |  || || | |     ||| | |  | |  ||    | |   |         | ||||  || ||           |  |..PS00001..      |  | |||||| |       |  |^***  |  |        |  ||||    |   |  |       | |||  | | | ||||  |  |              | |             |||||| |||         | | |    | ||   | | || |          | |            |     |      |   |  |||^***|  | |        ||| ||||             |  | |      | | |  |  | ^*** |    | |||| ||||| |||  ||    |   |           | |||||||       || ||         | |     |       |  || || ||   | |  || | | |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..          | | |||   |  |  | | | |     | |      | |      |  | |  |  |   | |  |        | ||||  ||| | || || || | | ||              | | |  ||  |   |   |       |||   || |  || ||             |  | |   ||||||  |  |  | ||     | |   |        |  || || | |     ||| | |  | |  ||    | |   |         | ||||  || ||           |  |..PS00004..      |  | |||||| |       |  |      |  |        |  ||||    |   |  |       | |||  | | | ||||  |  |              | |             **^*|| |||         | | |    | ||   | | || |          | |            |     |      |   |  |||  |||  | |        ||| ||||             |  | |      | | |  |  |   |  |    | |||| ||||| |||  ||    |   |           | |||||||       || ||         | |     |       |  || || ||   | |  || | | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          | | ^**   |  |  ^** | |     | |      ^**      |  | |  |  |   | |  |        | ||||  ^** | || || || | | ||              | | |  ||  |   |   |       |||   || |  || ||             |  | |   ^**|||  |  |  | ||     | |   |        |  || || | |     ||| | |  | |  ||    | |   |         | ||||  || ||           |  |..PS00005..      |  | |||^** |       |  |      |  |        |  ||||    |   |  |       | |||  | | | ||||  |  |              | |              || || |||         | | |    | ||   | | || |          | |            |     |      |   |  |||  ^**  ^**        ||| ||||             |  | |      | | |  |  |   |  |    | |||| ||||| |||  ||    |   |           | |||||||       || ||         | |     |       |  || || ||   | |  || | | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | | ||    |  |  |   | |     | |               |  | |  |  |   | ^***        | ||||  ||  | |^*** || | | ||              | | |  ||  |   |   |       |||   || |  || ||             |  | |   || |||  |  |  | ||     | |   |        |  || ^*** |     ||| | |  | |  ||    | |   |         | ||||  ^***|           |  |..PS00006..      ^*** ||| |  |       |  |      |  |        |  ||||    |   |  |       | |||  | | | ||||  |  |              | |              || |^***|         | | |    | ||   | | || |          | |            |     |      |   |  |||   |              ||| ||||             |  | |      | | ^***  |   ^***    | |||| ||||| ||^***|    |   |           ^***^***|       || ||         | |     |       |  || || ||   | |  || | | |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          | | ||    |  |  |   | |     | |               |  | |  |  |   |             | ||||  ||  | || |  || | | ||              | | |  ||  |   |   |       |||   || |  || ||             |  | |   || |||  |  |  | ||     | |   |        |  ||  | | |     ||| | |  | |  ||    | |   |         | ||||  ||  |           |  |..PS00007..      |  | ||| |  |       |  |      |  |        |  ||||    |   |  |       | |||  | | | ||||  |  |              | |              || || | |         | | |    | ||   | | || |          | |            ******^      |   |  |||   |              ||| ||||             |  | |      | |    |  |           | |||| ||||| |||   |    |   |             || || |       || ||         | |     ********^  || || ||   | |  || | | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | | ||    |  |  |   | |     | |               |  | |  |  |   |             | ||^*****  | || |  || | | ||              | | |  ||  |   |   |       |^*****| |  || ||             |  | |   || |||  |  |  | ||     | |   |        |  ||  | | |     ||| | |  | |  |^***** |   |         | ||^*****  |           |  |..PS00008..      |  | ||| |  |       |  |      |  |        ^*****|    |   |  |       | |||  | ^*****||  |  |              | |              || || | |         | | ^***** ||   | | || |          | |                         |   |  |^*****              |^*****|             |  | |      | |    |  |           | |||| ||||| |||   |    |   |             || || |       || ||         | |             |  || || ||   | |  || | | |
search RasMol script viewer Motif-ligand binding stats  PRENYLATION ..          | | ||    |  |  |   | |     | |               |  | |  |  |   |             | ||||  |   | || |  || | | ||              | | |  ||  |   |   |       | |    | |  || ||             |  | |   || |||  |  |  | ||     | |   |        |  ||  | | |     ||| | |  | |  |       |   |         | || |  |   |           |  |..PS00294..      |  | ||| |  |       |  |      |  |        |  || |    |   |  |       | |||  |   | ||||  |  |              | |              || || | |         | |      | ||   | | || |          | |                         |   |  | |                  | | || |             |  | |      | |    |  |           | |||| ||||| |||   |    |   |             || || |       || ||         | |             |  || || ||   | |  || | | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | | ||    |  |  |   | |     | |               |  | |  |  |   |             | ||||  |   | || |  || | | ||              | | |  ||  |   |   |       | |    | ***** ||             |  | |   || |||  |  |  | ||     | |   |        |  ||  | | |     ||| | |  | |  |       |   |         | || |  |   |           |  |..alphabetamotif..      |  | ||| |  |       |  |      |  |        ***** |    |   |  |       | |||  |   | ||||  |  |              | |              || || | |         | |      | ||   | | || |          | |                         |   |  | |                  | | || |             |  | |      | |    |  |           | |||| ||||| |||   |    |   |             ***** |       *****         | |             |  || || ||   | |  || | | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          | | ||    |  |  |   | |     | |               |  | |  |  |   |             | ||||  |   | || |  || | | ||              | | |  ||  |   |   |       | |    | |  || ||             |  | |   || |||  |  |  | ||     | |   |        |  ||  | | |     ||| | |  | |  |       |   |         | || |  |   |           |  |..asxmotif..      |  ***** |  |       |  |      |  |        |  || |    *****  |       | |||  |   | ||||  |  |              | |              || || | |         | |      | ||   | | || |          | |                         |   |  | |                  | | || |             |  | |      | |    |  |           | |||*****|| |||   |    |   |             || || |       || ||         | |             |  || || |***** |  || | | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..          | | ||    |  |  |   | |     | |               |  ***  |  |   |             | ||||  |   | || |  || | | ||              | | |  ||  |   |   |       | |    | |  || ||             |  | |   || |||  |  |  ***|     | |   |        |  ||  | | |     *** | |  | |  |       |   |         | || |  |   |           |  |..asxturn..      |  ***|  |  |       |  |      |  |        |  |***        |  |       | |||  |   | ||||  |  |              | |              || || | |         | |      | ||   | | || |          | |                         |   |  | |                  | | || |             |  ***      | |    |  |           | |||***| || |||   |    |   |             || || |       || ||         | |             |  || || |      |  || | | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | | ||    ****  |   | |     | |               |  | ****  |   |             ****||  |   | || |  || | | ||              | | |  ||  |   |   |       | |    | *******|             |  | |   *****|  |  |  |  |     | |   |        |  |**** | |      |  | |  | |  |       |   |         ******  |   |           ****..betaturn..      ****  ****  |       |  |      ****        ****| |        |  |       ****|  |   ****||  |  |              | |              ***** | |         | |      | ||   | | || |          | |                         |   |  | |                  | | ****             ****        | |    |  |           ********* ****||   |    |   |             *******       ****|         | |             |  ****| |      |  || | | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | | ||          |   | |     | |               |  |       |   |               ||||  |   | || |  || | | ||              | | |  ||  |   |   |       | |    | |   |  |             |  | |      | |  |  |  |  |     ***   |        |  |     | |      |  | |  | |  |       |   |         |  |    |   |               ..gammaturn..               |  |       |  |      |  |            | |        |  |         | |  |     ||||  |  |              | |               |  | | |         | |      | ||   | | || |          | |                         |   |  | |                  | |  | |             |  |        | |    |  |             | ||  |  |  ||   |    |   |                            |  |         ***             |   |  | |      |  || | | |
search RasMol script viewer Motif-ligand binding stats  nest ..          | | ||          |   | |     ***               |  |       |   |               ****  |   | || |  || | ***|              | | |  ||  |   |   |       ***    | |   |  |             |  | |      ***  |  |  |  |       |   |        |  |     ***      |  | |  | |  |       |   |         |  |    |   |               ..nest..               |  |       |  |      |  |            ***        |  |         ***  |     ****  |  |              ***               |  | | |         ***      ***|   | ***| |          ***                         |   |  ***                  ***  | |             |  |        ***    |  |             ***|  |  |  ||   |    |   |                            |  |                         |   |  | |      |  || | ***
search RasMol script viewer Motif-ligand binding stats  niche ..          | ****          |   ***                       ****       |   |                     |   ******  **** ****              *** ********   |   |              ***   ****             **** |           ****  ****       |   |        ****              **** **** ****       |   |         ****    |   |               ..niche..               ****       ****      ****                       ****           ****           ****                                **** ***                     |   |    ***          | |                         |   |                            ***             ****               ****             *******  ****|   |    |   |                            ****                         |   ******      |  ****    
search RasMol script viewer Motif-ligand binding stats  stmotif ..          |   |           |   |                                    *****                     *****    *****                                    |   |                                        | |                            *****                                               |   |                 *****               ..stmotif..                                                                                                                                                              |   |                 | |                         |   |                                                                                             *****    |   |                                                         |   |           |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..          *****           *****                                                                                                                *****                                        | |                                                                                *****                                     ..ststaple..                                                                                                                                                              *****                 | |                         *****                                                                                                      *****                                                         *****           *****      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                            ***                                                                                                                          ..stturn..                                                                                                                                                                                    ***                                                                                                                                                                                                                             

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : RIBONUCLEOSIDE TRIPHOSPHATE REDUCTASE
member of: CATH:search3.20.70.20/search3.30.1620.10/search3.90.1390.10GENE3D:searchG3DSA_3.20.70.20/searchG3DSA_3.90.1390.10PFAM:searchPF02867SUPERFAMILY:searchSSF51998TIGRFAMS:searchTIGR02505UniProt:searchQ59490
sec str:  ......hhhhhhhhhhhh......hhhhhhhhhh...hhhhh...hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..eeehhhhhhhh.hhhhhhh......eeeee...ee...............ee.hhhhhhhhhhhhh..eeeee.hhhhhh.........eeeee......hhhhhhhh...hhhhh......eeee...hhhhhhhhhhhhhhhhhhhhh.....eeeee....................hhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh..... ...eeeeee..hhhhhhh..hhhhhhhh...eeeeeee.....hhhhhhhhhhhhh..eeeehhhhhhh.hhhhh........eeee......eee......eeeehhhhhhhh..hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh..eeee.hhhhhhhhhh....eeeeeeee......eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhh.......ee...hhhhhhhhh...........eeeeeeeee...hhhhhhhhhh.eeee......eeeeeeeee..........hhhhhhhhhhhhhhhhhhhhh........eeehhhhhhhhhhhhhhh.....ee.eee..........eee.hhhhhhhhhhh...hhhhhhhhhhhhh....
sequence :  ..EISLSAEFIDRVKASVKPHWGKLGWVTYKRTYARWLPEKGRSENWDETVKRVVEGNINLDPRLQDSPSLELKQSLTEEAERLYKLIYGLGATPSGRNLWISGTDYQRRTGDSLNNCWFVAIRPQKYGDSKIVPSYLGKQEKAVSMPFSFLFDELMKGGGVGFSVARSNISQIPRVDFAIDLQLVVDETSESYDASVKVGAVGKNELVQDADSIYYRLPDTREGWVLANALLIDLHFAQTNPDRKQKLILDLSDIRPYGAEIHGFGGTASGPMPLISMLLDVNEVLNNKAGGRLTAVDAADICNLIGKAVVAGN... ..AELALGSNDDQDFISMKQDQEKLMHHRWASNNSVAVDSAFSGYQPIAAGIRENGEPGIVNLDLSKNYGRIVDGYQAGIDGDVEGTNPCGEISLANGEPCNLFEVFPLIAEEQGWDLQEVFALAARYAKRVTFSPYDWEISREIIQKNRRIGISMSGIQDWLLTRLGNRVVTGFKDDFDPETHEAIKVPVYDKRAIKMVDQLYKAVVKADQDYSKTLGCNESIKHTTVKPSGTVAKLAGASEGMHFHYGAYLIQRIRFQDSDPLLPALKACGYRTEADIYTENTTCVEFPIKAVGADNPNFASAGTVSIAEQFATQAFLQTYWSDNAVSCTITFQDSEGDQVESLLRQYRFITKSTSLLPYFGGSLQQAPKEPIDKETYEKRSQEITGNVEEVFSQLNSDVKDLE
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304          ... ..321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          ||| |||   | ||  | | | |  |  |||      | |      |  | |     |   | | ||        | ||||  ||| | || ||||| | | ||              | | |  ||  |            || |||   || |  ^***|             |  |     | || |   | |  |  |       |   |        |  || || | |     ||| | |  | |  ||    |               | ||||  ||||                ..PS00001..      |  |  | |||||       |  |^***  |  |        |   |||    | | |  | || || | |||  | | | ||||  |  |           || |||| |          |||||| |||         | | |    | ||   | | || |       | || |       | |  |     |             |||^***|  | |        ||| ||||             |  | |      | | |  | || ^*** |      | || ||| |  ||  |   |                 | |||| |         |  |        | |      |   |   |  || || |      |  || | | |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..          ||| |||   | ||  | | | |  |  |||      | |      |  | |     |   | | ||        | ||||  ||| | || ||||| | | ||              | | |  ||  |            || |||   || |  || ||             |  |     | || |   | |  |  |       |   |        |  || || | |     ||| | |  | |  ||    |               | ||||  ||||                ..PS00004..      |  |  | |||||       |  |      |  |        |   |||    | | |  | || || | |||  | | | ||||  |  |           || |||| |          **^*|| |||         | | |    | ||   | | || |       | || |       | |  |     |             |||  |||  | |        ||| ||||             |  | |      | | |  | ||   |  |      | || ||| |  ||  |   |                 | |||| |         |  |        | |      |   |   |  || || |      |  || | | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          ||| ^**   | ||  ^** | |  |  |||      ^**      |  | |     |   | | ||        | ||||  ^** | || ||||| | | ||              | | |  ||  |            || |||   || |  || ||             |  |     ^**| |   | |  |  |       |   |        |  || || | |     ||| | |  | |  ||    |               | ||||  ||||                ..PS00005..      |  |  | ^**||       |  |      |  |        |   |||    | | |  | || || | |||  | | | ||||  |  |           || |||| |           || || |||         | | |    | ||   | | || |       | || |       | |  |     |             |||  ^**  ^**        ||| ||||             |  | |      | | |  | ||   |  |      | || ||| |  ||  |   |                 | |||| |         |  |        | |      |   |   |  || || |      |  || | | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          ||| ||    | ||  |   | |  |  |||               |  | |     |   | ^***        | ||||   |  | |^***||| | | ||              | | |  ||  |            || |||   || |  || ||             |  |        | |   | |  |  |       |   |        |  || ^*** |     ||| | |  | |  ||    |               | ||||  ^***                ..PS00006..      ^***  | || ||       |  |      |  |        |   |||    | | |  | || || | |||  | | | ||||  |  |           || |||| |           || |^***|         | | |    | ||   | | || |       | || |       | |  |     |             |||   |              ||| ||||             |  | |      | | ^*** ||   ^***      | || ||| |  |^***   |                 ^***^***         |  |        | |      |   |   |  || || |      |  || | | |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          ||| ||    | ||  |   | |  |  |||               |  | |     |   |   |         | ||||   |  | || | ||| | | ||              | | |  ||  |            || |||   || |  || ||             |  |        | |   | |  |  |       |   |        |  ||  | | |     ||| | |  | |  ||    |               | ||||  |||                 ..PS00007..            | || ||       |  |      |  |        |   |||    | | |  | || || | |||  | | | ||||  |  |           || |||| |           || || | |         | | |    | ||   | | || |       | || |       | |  ******^             |||   |              ||| ||||             |  | |      | |    | ||             | || ||| |  |   |   |                   |  |           |  |        | |      ********^  || || |      |  || | | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          ||| ||    | ||  |   | |  |  |||               |  | |     |   |   |         | ||^*****  | || | ||| | | ||              | | |  ||  |            || |^*****| |  || ||             |  |        | |   | |  |  |       |   |        |  ||  | | |     ||| | |  | |  |^*****               | ||^*****|                 ..PS00008..            | || ||       |  |      |  |        ^*****|    | | |  | || || | |||  | ^*****||  |  |           || |||| |           || || | |         | | ^***** ||   | | || |       | || |       | |                      |^*****              |^*****|             |  | |      | |    | ||             | || ||| |  |   |   |                   |  |           |  |        | |          |   |  || || |      |  || | | |
search RasMol script viewer Motif-ligand binding stats  PRENYLATION ..          ||| ||    | ||  |   | |  |  |||               |  | |     |   |   |         | ||||      | || | ||| | | ||              | | |  ||  |            || |||    | |  || ||             |  |        | |   | |  |  |       |   |        |  ||  | | |     ||| | |  | |  |                     | || |  | |                 ..PS00294..            | || ||       |  |      |  |            | |    | | |  | || || | |||  |   | ||||  |  |           || |||| |           || || | |         | |      | ||   | | || |       | || |       | |                      | |                  | | || |             |  | |      | |    | ||             | || ||| |  |   |   |                   |  |           |  |        | |          |   |  || || |      |  || | | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          ||| ||    | ||  |   | |  *****|               |  | |     |   |   |         | ||||      | || | ||| | | ||              | | |  ||  |            || |||    | ***** ||             |  |        | |   | |  |  |       |   |        |  ||  | | |     ||| | |  | |  |                     | || |  | |                 ..alphabetamotif..            | || ||       |  |      |  |            | |    | | |  | || || | |||  |   | ||||  |  |           || |||| |           || || | |         | |      | ||   | | || |       | || |       | |                      | |                  | | || |             |  | |      | |    | ||             | || ||| |  |   |   |                   |  |           |  |        | |          |   |  || || |      |  || | | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          ||| ||    | ||  |   | |  |  | |               |  | |     |   |   |         | ||||      | || | ||| | | ||              | | |  ||  |            || |||    | |  || ||             |  |        | |   | |  |  |       |   |        |  ||  | | |     ||| | |  | |  |                     | || |  | |                 ..asxmotif..            | || ||       |  |      |  |            | |    *****  | || || | |||  |   | ||||  |  |           || |||| |           || || | |         | |      | ||   | | || |       | || |       | |                      | |                  | | || |             |  | |      | |    | ||             | |***** |  |   |   |                   |  |           |  |        | |          *****  || || |      |  || | | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..          ||| ||    | ||  |   | |  |  | |               |  ***     |   |   |         | ||||      | || | ||| | | ||              | | |  ||  |            || |||    | |  || ||             |  |        | |   | |  |  |       |   |        |  ||  | | |     *** | |  | |  |                     | || |  | |                 ..asxturn..            | || ||       |  |      |  |            ***    *** |  | || || | |||  |   | ||||  |  |           || |||***           || || | |         | |      | ||   | | || |       ***| |       ***                      | |                  | | || |             |  ***      | |    ***|             | |***|  |  |   |   |                   |  |           |  |        | |              |  || || |      |  || | | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |****|    ****  |   | |  **** |               |  |       |   |   |         ****||      | || | ||| | | ||              | | |  |****            |****|    | *******|             |  |        | |   | |  |  |       |   |        |  |**** | |      |  | **** |  |                     ******  | |                 ..betaturn..            ******|       |  |      |  |                       |  | ***** ****|  |   ****||  |  |           |****|              ****| | |         | |      | ||   | | || |          | |                                | |                  | | ****             |  |        | |    |  |             *******  |  |   |   |                   ****           |  |        | |              |  ***** |      |  || | | |
search RasMol script viewer Motif-ligand binding stats  nest ..          | | ||      |   |   | |     ***               |  |       |   |   |           ****      | || | ||| | ***|              | | |  ||  |            |  ***    | |   |  |             |  |        ***   | |  |  |       |   |        |  |     ***      |  | |  | |  |                     |  |    | |                 ..nest..               |  |       |  |      |  |                       |  |         ***  |     ****  |  |           |  ***               |  | | |         ***      ***|   | ***| |          ***                                ***                  ***  | |             |  |        ***    |  |             ***|  |  |  |   |   |                                  |  |        | |              |   |  | |      |  || | ***
search RasMol script viewer Motif-ligand binding stats  niche ..          | ****      |   |   ***                       ****       |   |   |                     ****** |**** ****              *** ********            |    |    ***   ****             ****              ***  ****       |   |        ****              **** **** ****                     ****    | |                 ..niche..               ****       ****      ****                       ****           ****           ****           |    |               **** ***                     |   |    ***                                                                       ***             ****               ****             *******  ****   |   |                                  ****        ***              |   ******      |  ****    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..          |   |       |   |   |                                    |   |   |                          | | | |                                           ******                                                             |   |                                                                     | |                 ..schellmannloop..                                                                                                            ******                                            |   |                                                                                                                                                  |   |                                                               |   |           |   |      
search RasMol script viewer Motif-ligand binding stats  stmotif ..          |   |       |   |   |                                    *****   |                          ***** |                                                                                                              *****                                                                     | |                 ..stmotif..                                                                                                                                                              |   |                                                                                                                                                  |   |                                                               |   |           |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..          *****       *********                                        *****                            *****                                                                                                                                                                                        | |                 ..ststaple..                                                                                                                                                              *****                                                                                                                                                  *****                                                               *****           *****      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                                                                                     ***                 ..stturn..                                                                                                                                                                                                                                                                                                                                                                                                                    

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : RIBONUCLEOSIDE TRIPHOSPHATE REDUCTASE
member of: CATH:search3.20.70.20/search3.30.1620.10/search3.90.1390.10GENE3D:searchG3DSA_3.20.70.20/searchG3DSA_3.90.1390.10PFAM:searchPF02867SUPERFAMILY:searchSSF51998TIGRFAMS:searchTIGR02505UniProt:searchQ59490
sec str:  ......hhhhhhhhhhhh......hhhhhhhhhh..ee....ee.hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..eeehhhhhhhh.hhhhhh.......eeeee...ee...............ee.hhhhhhhhhhhhh..eeeee.hhhhhh.........eeeeee.....hhhhhhhh..ee.hhh......eeee...hhhhhhhhhhhhhhhhhhhhh.....eeeee....................hhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh..... ...eeeeee..hhhhhhhhhhhhhhhhhhhhheeeeee......hhhhhhhhhhhh..eeeehhhhhhh.hhhhh........eeee......eee......eeeehhhhhhhh..hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh..eeee.hhhhhhhhhhh...eeeeeeee......eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhh.......ee...hhhhhhhhh...........eeeeeeeee....hhhhhhhh..eeee......eeeeeeeee..........hhhhhhhhhhhhhhhhhhhhh........eeehhhhhhhhhhhhhhh.....ee.eee..........eee.hhhhhhhhhhhh..hhhhhhhhhhhhh....
sequence :  ..EISLSAEFIDRVKASVKPHWGKLGWVTYKRTYARWLPEKGRSENWDETVKRVVEGNINLDPRLQDSPSLELKQSLTEEAERLYKLIYGLGATPSGRNLWISGTDYQRRTGDSLNNCWFVAIRPQKYGDSKIVPSYLGKQEKAVSMPFSFLFDELMKGGGVGFSVARSNISQIPRVDFAIDLQLVVDETSESYDASVKVGAVGKNELVQDADSIYYRLPDTREGWVLANALLIDLHFAQTNPDRKQKLILDLSDIRPYGAEIHGFGGTASGPMPLISMLLDVNEVLNNKAGGRLTAVDAADICNLIGKAVVAGN... ..AELALGSNDDQDFISMKQDQEKLMHHRWASNNSVAVDSAFSGYQPIAAGIRENGEPGIVNLDLSKNYGRIVDGYQAGIDGDVEGTNPCGEISLANGEPCNLFEVFPLIAEEQGWDLQEVFALAARYAKRVTFSPYDWEISREIIQKNRRIGISMSGIQDWLLTRLGNRVVTGFKDDFDPETHEAIKVPVYDKRAIKMVDQLYKAVVKADQDYSKTLGCNESIKHTTVKPSGTVAKLAGASEGMHFHYGAYLIQRIRFQDSDPLLPALKACGYRTEADIYTENTTCVEFPIKAVGADNPNFASAGTVSIAEQFATQAFLQTYWSDNAVSCTITFQDSEGDQVESLLRQYRFITKSTSLLPYFGGSLQQAPKEPIDKETYEKRSQEITGNVEEVFSQLNSDVKDLE
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304          ... ..321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    |   | |||||||   |  |  | | | |     | |      | |      |  | |     |   | | ||        | ||||  ||| | || ||||| | | ||              | | |  ||  |            || |||   || |  ^***|             |  | |   ||||||        |  |     | |   |        |  || || |||     ||| | |  | |  ||    |               | ||||  || |                ..PS00001..      |  |  | ||||| |     |  |^***  |  || |     |   |||        |  | || || | |||  ||| | ||||  |  |           || |||| |          | || | |||         | | |    | ||   | | || |       | || |       | |  |     |      |   |  |||^***|  | |   || ||||| ||||             |  | |      | | |  |  | ^*** |      | || ||||| |||  ||  |                 | |||| ||        |  |                 |       |   |  |                | |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    |   | |||||||   |  |  | | | |     | |      | |      |  | |     |   | | ||        | ||||  ||| | || ||||| | | ||              | | |  ||  |            || |||   || |  ||  |             |  | |   ||||||        |  |     | |   |        |  || || |||     ||| | |  | |  ||    |               | ||||  || |                ..PS00004..      |  |  | ||||| |     |  |      |  || |     |   |||        |  | || || | |||  ||| | ||||  |  |           || |||| |          **^* | |||         | | |    | ||   | | || |       | || |       | |  |     |      |   |  |||  |||  | |   || ||||| ||||             |  | |      | | |  |  |   |  |      | || ||||| |||  ||  |                 | |||| ||        |  |                 |       |   |  |                | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |   | ||||^**   |  |  ^** | |     | |      ^**      |  | |     |   | | ||        | ||||  ^** | || ||||| | | ||              | | |  ||  |            || |||   || |  ||  |             |  | |   ^**|||        |  |     | |   |        |  || || |||     ||| | |  | |  ||    |               | ||||  || |                ..PS00005..      |  |  | ^**|| |     |  |      |  || |     |   |||        |  | || || | |||  ||| | ||||  |  |           || |||| |            |  | |||         | | |    | ||   | | || |       | || |       | |  |     |      |   |  |||  ^**  ^**   || ||||| ||||             |  | |      | | |  |  |   |  |      | || ||||| |||  ||  |                 | |||| ||        |  |                 |       |   |  |                | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    |   | ||||||    |  |  |   | |     | |               |  | |     |   | ^***        | ||||  ||  | |^***||| | | ||              | | |  ||  |            || |||   || |  ||  |             |  | |   || |||        |  |     | |   |        |  || ^***||     ||| | |  | |  ||    |               | ||||  ^***                ..PS00006..      ^***  | || || |     |  |      |  || |     |   |||        |  | || || | |||  ||| | ||||  |  |           || |||| |            |  ^***|         | | |    | ||   | | || |       | || |       | |  |     |      |   |  |||   |         || ||||| ||||             |  | |      | | ^***  |   ^***      | || ||||| ||^***|  |                 ^***^***|        |  |                 |       |   |  |                | |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    |   | ||||||    |  |  |   | |     | |               |  | |     |   |   |         | ||||  ||  | || | ||| | | ||              | | |  ||  |            || |||   || |  ||  |             |  | |   || |||        |  |     | |   |        |  ||  | |||     ||| | |  | |  ||    |               | ||||   |                  ..PS00007..            | || || |     |  |      |  || |     |   |||        |  | || || | |||  ||| | ||||  |  |           || |||| |            |  | | |         | | |    | ||   | | || |       | || |       | |  ******^      |   |  |||   |         || ||||| ||||             |  | |      | |    |  |             | || ||||| |||  ||  |                   |  |  |        |  |                 ********^   |  |                | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    |   | ||||||    |  |  |   | |     | |               |  | |     |   |   |         | ||^*****  | || | ||| | | ||              | | |  ||  |            || |^*****| |  ||  |             |  | |   || |||        |  |     | |   |        |  ||  | |||     ||| | |  | |  |^*****               | ||^*****                  ..PS00008..            | || || |     |  |      |  || |     ^*****|        |  | || || | |||  ||^*****||  |  |           || |||| |            |  | | |         | | ^***** ||   | | || |       | || |       | |               |   |  |^*****         || |||^*****|             |  | |      | |    |  |             | || ||||| |||  ||  |                   |  |  |        |  |                         |   |  |                | |
search RasMol script viewer Motif-ligand binding stats  PRENYLATION ..    |   | ||||||    |  |  |   | |     | |               |  | |     |   |   |         | ||||  |   | || | ||| | | ||              | | |  ||  |            || |||    | |  ||  |             |  | |   || |||        |  |     | |   |        |  ||  | |||     ||| | |  | |  |                     | || |                      ..PS00294..            | || || |     |  |      |  || |         | |        |  | || || | |||  ||| | ||||  |  |           || |||| |            |  | | |         | |      | ||   | | || |       | || |       | |               |   |  | |             || ||| | || |             |  | |      | |    |  |             | || ||||| |||  ||  |                   |  |  |        |  |                         |   |  |                | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    |   | *****|    |  |  |   | |     | |               |  | |     |   |   |         | ||||  |   | || | ||| | | ||              | | |  ||  |            || |||    | *****  |             |  | |   || |||        |  |     | |   |        |  ||  | |||     ||| | |  | |  |                     | || |                      ..alphabetamotif..            | || || |     |  |      |  || |         | |        |  | || || | |||  ||| | ||||  |  |           || |||| |            |  | | |         | |      | ||   | | || |       | || |       | |               |   |  | |             *****| | || |             |  | |      | |    |  |             | || ||||| |||  ||  |                   |  |  |        |  |                         |   |  |                | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    |   | ||||||    |  |  |   | |     | |               |  | |     |   |   |         | ||||  |   | || | ||| | | ||              | | |  ||  |            || |||    | |  ||  |             |  | |   || |||        |  |     | |   |        |  ||  | |||     ||| | |  | |  |                     | || |                      ..asxmotif..            | || || |     |  |      |  || |         | |        |  | || || | |||  ||| | ||||  |  |           || |||| |            |  | | |         | |      | ||   | | || |       | || |       | |               |   |  | |             || ||| | || |             |  | |      | |    |  |             | |*****|| |||  ||  |                   |  |  |        |  |                         |   |  |                | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..    |   | ||||||    |  |  |   | |     | |               |  ***     |   |   |         | ||||  |   | || | ||| | | ||              | | |  ||  |            || |||    | |  ||  |             |  | |   || |||        |  |     | |   |        |  ||  | |||     *** | |  | |  |                     | || |                      ..asxturn..            | || |***     |  |      |  || |         ***        |  | || || | |||  ||| | ||||  |  |           || |||***            |  | | |         | |      | ||   | | || |       ***| |       ***               |   |  | |             || ||| | || |             |  ***      | |    |  |             | |***| || |||  ||  |                   |  |  |        |  |                         |   |  |                | |
search RasMol script viewer Motif-ligand binding stats  betabulge ..    |   | ||||||    |  |  |   | |     | |               |  |       |   |   |         | ||||  |   | || | ||| | | ||              | | |  ||  |            || |||    | |  ||  |             |  | |   || |||        |  |     | |   |        |  ||  | |||      |  | |  | |  |                     | || |                      ..betabulge..            | || ||       |  |      |  || |                    |  | || || | |||  |** | ||||  |  |           || |||               |  | | |         | |      | ||   | | || |          | |                         |   |  | |             || ||| | || |             |  |        | |    |  |             | ||  | || |||  ||  |                   |  |  |        |  |                         |   |  |                | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |   | *****|    ****  |   | |     | |               |  |       |   |   |         ****||  |   | **** ||| | | ||              | | |  |****            |****|    | ********             |  | |   |****|        |  |     | |   |        |  |*******|      |  | **** |  |                     ******                      ..betaturn..            ******|       |  |      ****| |                    |  | ***** ********   ****||  |  |           |****|               |  | | |         | |      | ||   | | || |          | |                         |   |  | |             *****| | ****             ****        | |    |  |             ******* ****||  ||  |                   *******        |  |                         |   |  |                | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    |   |   |  |          |   | |     | |               |  |       |   |   |           ||||  |   | || | ||| | | ||              | | |  ||  |            |  | |    | |   |  |             |  | |   |  | |        |  |     ***   |        |  |     | |      |  | |  | |  |                     |  |                        ..gammaturn..               |  |       |  |      |  |***                    |  |         | |  |     ||||  |  |           |  | |               |  | | |         | |      | ||   | | || |          | |                         |   |  | |                  | |  | |             |  |        | |    |  |             | ||  |  |  ||  ||  |                                  |  |                         |   |  |                | |
search RasMol script viewer Motif-ligand binding stats  nest ..    |   |   |  |          |   | |     ***               |  |       |   |   |           ****  |   | || | ||| | ***|              | | |  ||  |            |  ***    | |   |  |             |  | |   |  ***        |  |       |   |        |  |     ***      |  | |  | |  |                     |  |                        ..nest..               |  |       |  |      |  |                       |  |         ***  |     ****  |  |           |  ***               |  | | |         ***      ***|   | ***| |          ***                         |   |  ***                  ***  | |             |  |        ***    |  |             ***|  |  |  ||  ||  |                                  |  |                         |   |  |                ***
search RasMol script viewer Motif-ligand binding stats  niche ..    |   |   ****          |   ***                       ****       |   |   |                 |   ****** |**** ****              *** ********            |    |    ***   ****             **** |   |    |        ****       |   |        ****              **** **** ****                     ****                        ..niche..               ****       ****      ****                       ****           ****           ****           |    |               **** ***                     |   |    ***                                      |   |                            ***             ****               ****             *******  ****|  ||  |                                  ****                         |   ****                   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..    |   |                 |   |                                    |   |   |                 |   |    | | | |                                           ******                                |   ******                   |   |                                                                                         ..schellmannloop..                                                                                                            ******                                            |   |                                             |   |                                                                                             |  ||  |                                                               |   |                      
search RasMol script viewer Motif-ligand binding stats  stmotif ..    *****                 |   |                                    *****   |                 *****    ***** |                                                                                 |   |                        *****                                                                                         ..stmotif..                                                                                                                                                              |   |                                             |   |                                                                                             *****  |                                                               |   |                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                          *****                                        *****                            *****                                                                                 *****                                                                                                                      ..ststaple..                                                                                                                                                              *****                                             *****                                                                                                *****                                                               *****                      

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : RIBONUCLEOSIDE TRIPHOSPHATE REDUCTASE
member of: CATH:search3.20.70.20/search3.30.1620.10/search3.90.1390.10GENE3D:searchG3DSA_3.20.70.20/searchG3DSA_3.90.1390.10PFAM:searchPF02867SUPERFAMILY:searchSSF51998TIGRFAMS:searchTIGR02505UniProt:searchQ59490
sec str:  ......hhhhhhhhhh........hhhhhhhh....ee....ee.hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh..eeehhhhhhhh.hhhhhhh......eeeee...ee...............ee.hhhhhhhhhhhhh..eeeee.hhhhhh.........eeeee......hhhhhhhh..............eeee...hhhhhhhhhhhhhhhhhhhhh.....eeeee....................hhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh..... ...eeeeee..hhhhhhhhhhhhhhhhh...eeeeeee.....hhhhhhhhhh.....eeeehhhhhhh.hhhhh........eeee......eee......eeeehhhhhhhh..hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh..eeee.hhhhhhhhhhh...eeeeeeee......eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhh.......ee...hhhhhhhhh...........eeeeeeeee...hhhhhhhhh...eee......eeeeeeeee..........hhhhhhhhhhhhhhhhhhhhh.......eeeehhhhhhhhhhhhhhh.....eeeeee..........eee.hhhhhhhhhhhh..hhhhhhhhhhhhh....
sequence :  ..EISLSAEFIDRVKASVKPHWGKLGWVTYKRTYARWLPEKGRSENWDETVKRVVEGNINLDPRLQDSPSLELKQSLTEEAERLYKLIYGLGATPSGRNLWISGTDYQRRTGDSLNNCWFVAIRPQKYGDSKIVPSYLGKQEKAVSMPFSFLFDELMKGGGVGFSVARSNISQIPRVDFAIDLQLVVDETSESYDASVKVGAVGKNELVQDADSIYYRLPDTREGWVLANALLIDLHFAQTNPDRKQKLILDLSDIRPYGAEIHGFGGTASGPMPLISMLLDVNEVLNNKAGGRLTAVDAADICNLIGKAVVAGN... ..AELALGSNDDQDFISMKQDQEKLMHHRWASNNSVAVDSAFSGYQPIAAGIRENGEPGIVNLDLSKNYGRIVDGYQAGIDGDVEGTNPCGEISLANGEPCNLFEVFPLIAEEQGWDLQEVFALAARYAKRVTFSPYDWEISREIIQKNRRIGISMSGIQDWLLTRLGNRVVTGFKDDFDPETHEAIKVPVYDKRAIKMVDQLYKAVVKADQDYSKTLGCNESIKHTTVKPSGTVAKLAGASEGMHFHYGAYLIQRIRFQDSDPLLPALKACGYRTEADIYTENTTCVEFPIKAVGADNPNFASAGTVSIAEQFATQAFLQTYWSDNAVSCTITFQDSEGDQVESLLRQYRFITKSTSLLPYFGGSLQQAPKEPIDKETYEKRSQEITGNVEEVFSQLNSDVKDLE
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304          ... ..321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    |  || ||| |||   | ||  | | | |     | |      | |      |  | |     |   | | ||        | ||||  ||| | || ||||| | | ||              | | |  ||  |               |||   |  |  ^***|             |  | |   | || |        | ||     | |   |        |  || || | |     ||| | |  | |  ||    | |   |         | ||||  || |                ..PS00001..      |  | |||||| |       |  |^***  |  |        |  ||||    |   |  | |  |  | |||  ||| | ||||  |  |           || |||             | || | |||         | | |    | ||   | | || |       |  |||       | |  |     |      | | | ||||^***|  | |    |  |||| ||||             |  |        | | |  |  | ^*** |      | || ||||| |||  ||  | |   |           | |||||||       || ||                 |   |   |   |     |   |         | |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    |  || ||| |||   | ||  | | | |     | |      | |      |  | |     |   | | ||        | ||||  ||| | || ||||| | | ||              | | |  ||  |               |||   |  |  || ||             |  | |   | || |        | ||     | |   |        |  || || | |     ||| | |  | |  ||    | |   |         | ||||  || |                ..PS00004..      |  | |||||| |       |  |      |  |        |  ||||    |   |  | |  |  | |||  ||| | ||||  |  |           || |||             **^* | |||         | | |    | ||   | | || |       |  |||       | |  |     |      | | | ||||  |||  | |    |  |||| ||||             |  |        | | |  |  |  ||  |      | || ||||| |||  ||  | |   |           | |||||||       || ||                 |   |   |   |     |   |         | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  || ||| ^**   | ||  ^** | |     | |      ^**      |  | |     |   | | ||        | ||||  ^** | || ||||| | | ||              | | |  ||  |               |||   |  |  || ||             |  | |   ^**| |        | ||     | |   |        |  || || | |     ||| | |  | |  ||    | |   |         | ||||  || |                ..PS00005..      |  | |||^** |       |  |      |  |        |  ||||    |   |  | |  |  | |||  ||| | ||||  |  |           || |||             | || | |||         | | |    | ||   | | || |       |  |||       | |  |     |      | | | ||||  ^**  ^**    |  |||| ||||             |  |        | | |  |  |  ||  |      | || ||||| |||  ||  | |   |           | |||||||       || ||                 |   |   |   |     |   |         | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    |  || ||| ||    | ||  |   | |     | |               |  | |     |   | ^***        | ||||   |  | |^***||| | | ||              | | |  ||  |               |||   |  |  || ||             |  | |   |  | |        | ||     | |   |        |  || ^*** |     ||| | |  | |  ||    | |   |         | ||||  ^***                ..PS00006..      ^*** ||| |  |       |  |      |  |        |  ||||    |   |  | |  |  | |||  ||| | ||||  |  |           || |||             | || ^***|         | | |    | ||   | | || |       |  |||       | |  |     |      | | | ||||   |          |  |||| ||||             |  |        | | ^***  |  |^***      | || ||||| ||^***|  | |   |           ^***^***|       || ||                 |   |   |   |     |   |         | |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    |  || ||| ||    | ||  |   | |     | |               |  | |     |   |   |         | ||||   |  | || | ||| | | ||              | | |  ||  |               |||   |  |  || ||             |  | |   |  | |        | ||     | |   |        |  ||  | | |     ||| | |  | |  ||    | |   |         | ||||   |                  ..PS00007..         | ||| |  |       |  |      |  |        |  ||||    |   |  | |  |  | |||  ||| | ||||  |  |           || |||             | || | | |         | | |    | ||   | | || |       |  |||       | |  ******^      | | | ||||   |          |  |||| ||||             |  |        | |    |  |  |          | || ||||| |||  ||  | |   |             || || |       || ||                 ********^   |     |   |         | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    |  || ||| ||    | ||  |   | |     | |               |  | |     |   |   |         | ||^*****  | || | ||| | | ||              | | |  ||  |               |^*****  |  || ||             |  | |   |  | |        | ||     | |   |        |  ||  | | |     ||| | |  | |  |^***** |   |         | ||^*****                  ..PS00008..         | ||| |  |       |  |      |  |        ^*****|    |   |  | |  |  | |||  ||^*****||  |  |           || |||             | || | | |         | | ^***** ||   | | || |       |  |||       | |               | | | ||^*****          |  ||^*****|             |  |        | |    |  |  |          | || ||||| |||  ||  | |   |             || || |       || ||                     |   |   |     |   |         | |
search RasMol script viewer Motif-ligand binding stats  PRENYLATION ..    |  || ||| ||    | ||  |   | |     | |               |  | |     |   |   |         | ||||      | || | ||| | | ||              | | |  ||  |               | |      |  || ||             |  | |   |  | |        | ||     | |   |        |  ||  | | |     ||| | |  | |  |       |   |         | || |                      ..PS00294..         | ||| |  |       |  |      |  |        |  || |    |   |  | |  |  | |||  ||| | ||||  |  |           || |||             | || | | |         | |      | ||   | | || |       |  |||       | |               | | | || |              |  || | || |             |  |        | |    |  |  |          | || ||||| |||  ||  | |   |             || || |       || ||                     |   |   |     |   |         | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    |  *****| ||    | ||  |   | |     | |               |  | |     |   |   |         | ||||      | || | ||| | | ||              | | |  ||  |               | |      ***** ||             |  | |   |  | |        | ||     | |   |        |  ||  | | |     ||| | |  | |  |       |   |         | || |                      ..alphabetamotif..         | ||| |  |       |  |      |  |        ***** |    |   |  | |  |  | |||  ||| | ||||  |  |           || |||             | || | | |         | |      | ||   | | || |       |  |||       | |               | | | || |              |  || | || |             |  |        | |    |  |  |          | || ||||| |||  ||  | |   |             ***** |       *****                     |   |   |     |   |         | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    |  || ||| ||    | ||  |   | |     | |               |  | |     |   |   |         | ||||      | || | ||| | | ||              | | |  ||  |               | |      |  || ||             |  | |   |  | |        | ||     | |   |        |  ||  | | |     ||| | |  | |  |       |   |         | || |                      ..asxmotif..         ***** |  |       |  |      |  |        |  || |    *****  | |  |  | |||  ||| | ||||  |  |           || |||             | || | | |         | |      | ||   | | || |       *****|       | |               | | | || |              |  || | || |             |  |        | |    |  |  |          | |*****|| |||  ||  | |   |             || || |       || ||                     *****   |     *****         | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..    |  || ||| ||    | ||  |   | |     | |               |  ***     |   |   |         | ||||      | || | ||| | | ||              | | |  ||  |               | |      |  || ||             |  | |   |  | |        ***|     | |   |        |  ||  | | |     *** | |  | |  |       |   |         | || |                      ..asxturn..         ***|  |  |       |  |      |  |        |  |***        |  | |  |  | |||  ||| | ||||  |  |           || |||             | || | | |         | |      | ||   | | || |       |  | |       ***               | | | || |              |  || | || |             |  |        | |    |  |  |          | |***| || |||  ||  | |   |             || || |       || ||                         |   |                   | |
search RasMol script viewer Motif-ligand binding stats  betabulge ..    |  || ||| ||    | ||  |   | |     | |               |  |       |   |   |         | ||||      | || | ||| | | ||              | | |  ||  |               | |      |  || ||             |  | |   |  | |        |  |     | |   |        |  ||  | | |      |  | |  | |  |       |   |         | || |                      ..betabulge..            |  |  |       |  |      |  |        |  || |        |  | |  |  | |||  |** | ||||  |  |           || |||             | || | | |         | |      | ||   | | || |       |  | |                         | | | || |              |  || | || |             |  |        | |    |  |  |          | ||  | || |||  ||  | |   |             || || |       || ||                         |   |                   | |
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    |  || ||| ||    | ||  |   | |     | |               |  |       |   |   |         | ||||      | || | ||| | | ||              | | |  ||  |               | |      |  || ||             |  | |   |  | |        |  |     | |   |        |  ||  | | |      |  | |  | |  |       |   |         | || |                      ..betabulgeloop..            |  |  |       |  |      |  |        |  || |        |  | |  |  | |||  |   | ||||  |  |           || |||             | || | | |         | |      | ||   | | || |       ******                         | | | || |              |  || | || |             |  |        | |    |  |  |          | ||  | || |||  ||  | |   |             || || |       || ||                         |   |                   | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |  ********|    ****  |   | |     | |               |  |       |   |   |         ****||      | **** ||| | | ||              | | |  |****               | |      ********             |  | |   |  | |        |  |     | |   |        ******** | |      |  | **** |  |       |   |         ******                      ..betaturn..            ****  |       |  |      ****        ****| |        |  | ****  ****|  |   ****||  |  |           |****|             **** | | |         | |      | ||   | | || |          | |                         | | | || |              ****| | ****             ****        | |    |  |  |          ******* ****||  ||  | |   |             *******       ****|                         |   |                   | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    |   | | | ||      |   |   | |     | |               |  |       |   |   |           ||||      | || | ||| | | ||              | | |  ||  |               | |          |  |             |  | |   |  | |        |  |     ***   |        |  |     | |      |  | |  | |  |       |   |         |  |                        ..gammaturn..               |  |       |  |      |  |            | |        |  |         | |  |     ||||  |  |           |  | |               |  | | |         | |      | ||   | | || |          | |                         | | | || |                  | |  | |             |  |        | |    |  |  |          | ||  |  |  ||  ||  | |   |                            |  |                         |   |                   | |
search RasMol script viewer Motif-ligand binding stats  nest ..    |   | | | ||      |   |   | |     ***               |  |       |   |   |           ****      | || | ||| | ***|              | | |  ||  |               ***          |  |             |  | |   |  ***        |  |       |   |        |  |     ***      |  | |  | |  |       |   |         |  |                        ..nest..               |  |       |  |      |  |            ***        |  |         ***  |     ****  |  |           |  ***               |  | | |         ***      ***|   | ***| |          ***                         | | | |***                  ***  | |             |  |        ***    |  |  |          ***|  |  |  ||  ||  | |   |                            |  |                         |   |                   ***
search RasMol script viewer Motif-ligand binding stats  niche ..    |   | | ****      |   |   ***                       ****       |   |   |                     ****** |**** ****              *** ********                            ****             **** |   |             ****       |   |        ****              **** **** ****       |   |         ****                        ..niche..               ****       ****      ****                       ****           ****           ****           |    |               **** ***                     |   |    ***          | |                         | | | |                          ***             ****               *******          *******  ****|  ||  | |   |                            ****                         |   |                      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..    |   | |   |       |   |                                        |   |   |                          | | | |                                                                                 |   |                        |   |                                               |   |                                     ..schellmannloop..                                                                                                            ******                                            |   |                 | |                         | | | |                                                                                           |  ||  | |   |                                                         |   |                      
search RasMol script viewer Motif-ligand binding stats  stmotif ..    ***** |   |       |   |                                        *****   |                          ***** |                                                                                 |   |                        *****                                               |   |                                     ..stmotif..                                                                                                                                                              |   |                 | |                         | | | |                                                                                           *****  | |   |                                                         |   |                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..          *****       *****                                            *****                            *****                                                                                 *****                                                                            *****                                     ..ststaple..                                                                                                                                                              *****                 | |                         *******                                                                                              ***** *****                                                         *****                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                                                                                                         ..stturn..                                                                                                                                                                                    ***                                                                                                                                                                                                                             

   New search    1l1l:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML