triangle PDBeMotif: 1kgs  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification dna binding protein    | release date: Wed, Nov 28, 2001
Title crystal structure at 1.50 a of an ompr/phob homolog from the maritima
Authors A.M.STOCK, D.R.BUCKLER, Y.ZHOU
Method X-RAY DIFFRACTION (resolution: 1.50Å)
PDBe Citation   
Small molecules:    search SCN SCN binding statistics SCN
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MNVRVLVVEDERDLADLITEALKKEMFTVDVCYDGEEGMYMALNEPFDVVILDIMLPVHDGWEILKSMRESGVNTPVLML
TALSDVEYRVKGLNMGADDYLPKPFDLRELIARVRALIRRKSESKSTKLVCGDLILDTATKKAYRGSKEIDLTKKEYQIL
EYLVMNKNRVVTKEELQEHLWSFDDEVFSDVLRSHIKNLRKKVDKGFKKKIIHTVRGIGYVARDE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DNA BINDING RESPONSE REGULATOR D
member of: CATH:search1.10.10.10/search3.40.50.2300GENE3D:searchG3DSA_1.10.10.10/searchG3DSA_3.40.50.2300PANTHER:searchPTHR26402/searchPTHR26402_SF316PFAM:searchPF00072/searchPF00486PFAMB:searchPB009218/searchPB019578PROSITE PROFILES:searchPS50110, SMART:searchSM00448/searchSM00862SUPERFAMILY:searchSSF52172UniProt:searchQ9WYN0
JMol viewer RasMol script viewer  SCN 306A  ..                   *  *                                                                                                                                                             ..SCN ..                                       
JMol viewer RasMol script viewer  SCN 305A  ..                   |  |                                                                                                                                                             ..SCN ..                          *         * *
JMol viewer RasMol script viewer  SCN 304A  ..                   |  |              **   *                                                                                                                                         ..SCN ..                          |         | |
JMol viewer RasMol script viewer  SCN 303A  ..                   |  |              ||   |                                                                                                                           *             ..SCN ..                          |         * |
JMol viewer RasMol script viewer  SCN 302A  ..                   |  |              ||   |                                             *                                                                             |             ..SCN ..                          |         | |
JMol viewer RasMol script viewer  SCN 301A  ..                   |  |              ||   |                                             |                         *  **              *        ****                    |             ..SCN ..                          |         | |
sec str:  ....eeeee..hhhhhhhhhhhhhhh..eeeee.hhhhhhhhhhhh...eeeee......hhhhhhhhhhhh.....eeeee..hhhhhhhhh......eeee...hhhhhhhhhhhhhhhhh.....eeee..eeee....eeee..eee..hhhhhhhhhhhhhh....eehhhhhhhh.... ..hhhhhhhhhhhhhhhhhhh......eeee...eeee...
sequence :  ..NVRVLVVEDERDLADLITEALKKEMFTVDVCYDGEEGMYMALNEPFDVVILDIMLPVHDGWEILKSMRESGVNTPVLMLTALSDVEYRVKGLNMGADDYLPKPFDLRELIARVRALIRRKSESKSTKLVCGDLILDTATKKAYRGSKEIDLTKKEYQILEYLVMNKNRVVTKEELQEHLW... ..VFSDVLRSHIKNLRKKVDKGFKKKIIHTVRGIGYVARDE
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       ... ..187       197       207       217      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       | |           | |||      | | |   || |       | |    |  ||  | ||||| |        |  | | ||| | |        | |          **^*  || |   | |  | || |       | || |||      | || |  |  |||  | ..PS00004..               | || | || | ||||||      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |           | |||      | | |   || |       | |    |  ||  ^**|||| |        |  | | ||| | |        | |          |  |  |^**   | |  | |^**       | |^**||      | || |  |  |||  | ..PS00005..               | || | || | ^**|||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |           | |||      | | |   || |       | |    |  ||  ^***||| |        ^*** | ||| | |        | |          |  |  |  |   | |  | || |       | |^***|      | || |  ^***||  | ..PS00006..               | || | || |  | |||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |           | |||      | | ^***** |       | |    |  ||  | | ||| |             | |^*****        | |          |  |  |  |   | |  | || |       | ||   |      | || |  |   ||  | ..PS00008..               | || | || |  | |||      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       | |           | |||      *****   |  |       | |    *****  | | ||| |             | ||| | |        | |          |  |  |  |   | |  | || |       | ||   |      | || |  |   ||  | ..asxmotif..               | || | || |  | |||      
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |           | |||      ***     |  |       ***       |   | | ||| |             | ||| | |        ***          |  |  |  |   | |  ***| |       | ||   |      | || |  |   ||  | ..asxturn..               | || | || |  | |||      
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |           ****|              |  |       | |       |   | ****| |             ****| | |                     |  |  |  |   | |     | |       | ||   |      | ****  |   ||  | ..betaturn..               | || | || |  ****|      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | |             | |              |  |       | |       |   |   | | |               | | | |                     |  |  |  |   | |     | |       ***|   |      | || |  |   ||  | ..gammaturn..               | || | || |    | |      
search RasMol script viewer Motif-ligand binding stats  nest ..       | |             ***              |  |       | |       |   |   *** |               *** ***                     |  |  |  |   | |     ***          |   |      | || |  |   ||  | ..nest..               | || | || |    ***      
search RasMol script viewer Motif-ligand binding stats  niche ..       ***                              ****       ***       |   |   | ***                                           ****  ****   ***                  |   |      ******  |   |**** ..niche..               ***********             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                             |   |   |                                                                                 *****              *****     ..stmotif..                                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                             *********                                                                                                              ..ststaple..                                       

   New search    1kgs:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors