triangle PDBeMotif: 1kc2  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.1.112
Classification transferase    | release date: Wed, Nov 7, 2001
Title structure of the triple (lys(beta)d3ala, asp(beta)c8ala, aspcd2ala) mutant of the src sh2 domain bound to the pqpyeeipi peptide
Authors G.WAKSMAN, O.Y.LUBMAN
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Small molecules:    search CO CO binding statistics CO
Modified residues:  search PTR PTR binding statistics PTR
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSAFANAKGLNVAHYKIRKLDSGGFYITSRTQFSSLQ
QLVAYYSKHADGLCHRLTNVCPT
Chain B sequence:
PQYEEIPI
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SRC TYROSINE KINASE
member of: CATH:search3.30.505.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF53PFAM:searchPF00017PRINTS:searchSH2DOMAINPROSITE PROFILES:searchPS50001, SMART:searchSM00252SUPERFAMILY:searchSSF55550UniProt:searchP00524
JMol viewer RasMol script viewer  CO 2000A  ..                                             ..                                                   
sec str:  ......eee..hhhhhhhhhh.......eeeeee.......eeeee......eeeeeee.....eeee..eee.hhhhhhhhhh...........ee...
sequence :  ..AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVS..LNVAHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT
seq num:  ..147       157       167       177       187  ..199       209       219       229       239        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  |    |**^* ||  |  ||  |     | ||| |      ..    |             | ||        | |||||| ||          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |    ^**|^**|  |  ||  |     | ^** |      ..    |             ^**|        | |||||| ||          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  |    ^***   |  |  ||  |     |  |  |      ..    |             |  |        | |||||| ||          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |    | |    |  |  ||  |     |  |  |      ..*****             |  |        | |||||| ||          
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****    | |    |  ********     |  |  |      ..                  |  |        | ****|****          
search RasMol script viewer Motif-ligand binding stats  nest .. |  |    | |    |  |  ||  |     |  |  |      ..                  |  |        |  || |***           
search RasMol script viewer Motif-ligand binding stats  niche .. ****    | |    ***********     *******      ..                  ****        |  ****              
search RasMol script viewer Motif-ligand binding stats  ststaple ..         | |                                 ..                              *****                
search RasMol script viewer Motif-ligand binding stats  stturn ..         ***                                 ..                                                   

chain B : PQPYEEIPI PEPTIDE
sec str:  ..........
sequence :  ..PQYEEIPI
seq num:  ..302     

   New search    1kc2:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML