triangle PDBeMotif: 1jyu  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification signaling protein    | release date: Thu, Sep 13, 2001
Title xray structure of grb2 sh2 domain
Authors A.DUCRUIX, B.ROQUES, C.GARBAY, F.CHARBONNIER, I.BROUTIN, M.-T.LATREILLE, M.V, P.NIOCHE, W.-Q.LIU
Method X-RAY DIFFRACTION (resolution: 2.75Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSMAWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH
RSTSVSRNQQIFLRDI
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
member of: CATH:search3.30.505.10GENE3D:searchG3DSA_3.30.505.10PANTHER:searchPTHR22820/searchPTHR22820_SF27PFAM:searchPF00017PRINTS:searchP67PHOX/searchSH2DOMAINPROSITE PROFILES:searchPS50001/searchPS50002, SMART:searchSM00252/searchSM00326SUPERFAMILY:searchSSF50044/searchSSF55550UniProt:searchP62993
sec str:  .......eeee.hhhhhhhhhh......eeeeee.......eeeeeee..eeeeee.ee.....ee.......hhhhhhhhh................
sequence :  ..GSMAWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDI
seq num:  ..56        66        76        86        96        106       116       126       136       146   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |    |  | |  || | |  |        |  |   ^**|| |        | |||         |  |    |  || |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |    |  | |  || | |  |        |  |      || |        | |||         ^***    |  || |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |    |  | ***** | |  |        |  |      || |        | |||                 |  || |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  |    |  | |  |  | |  |        |  |      || |        *****                 |  || |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |    |  | |  |  | |  |        |  |      || |        ***||                 |  || |          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  |  |    |  | |  |  | |  |        |  |      || |        *****                 |  || |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |    **** ******* ****        |  |      ****        ****|                 |  || |          
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |            |  | |  |        |  |       | |          ***                 |  || |          
search RasMol script viewer Motif-ligand binding stats  niche ..  ****            *********        ****       ***                              ****| |          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                   ***          

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
member of: CATH:search3.30.505.10GENE3D:searchG3DSA_3.30.505.10PANTHER:searchPTHR22820/searchPTHR22820_SF27PFAM:searchPF00017PRINTS:searchP67PHOX/searchSH2DOMAINPROSITE PROFILES:searchPS50001/searchPS50002, SMART:searchSM00252/searchSM00326SUPERFAMILY:searchSSF50044/searchSSF55550UniProt:searchP62993
sec str:  .......eeee.hhhhhhhhhh......eeeeee.......eeeeeee..eeeeee.ee.....ee.......hhhhhhhhh................
sequence :  ..GSMAWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDI
seq num:  ..56        66        76        86        96        106       116       126       136       146   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |    |  | |  || | |  |        |  |   ^**|| |        | |||         |  |    |  || |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |    |  | |  || | |  |        |  |      || |        | |||         ^***    |  || |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |    |  | ***** | |  |        |  |      || |        | |||                 |  || |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  |    |  | |  |  | |  |        |  |      || |        *****                 |  || |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |    |  | |  |  | |  |        |  |      || |        ***||                 |  || |          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  |  |    |  | |  |  | |  |        |  |      || |        *****                 |  || |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |    **** ******* ****        |  |      ****        ****|                 |  || |          
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |            |  | |  |        |  |       | |          ***                 |  || |          
search RasMol script viewer Motif-ligand binding stats  niche ..  ****            *********        ****       ***                              ****| |          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                   ***          

   New search    1jyu:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML