triangle PDBeMotif: 1jo8  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification structural protein    | release date: Fri, Jul 27, 2001
Title structural analysis of the yeast actin binding protein abp1 sh3 domain
Authors A.DOUANGAMATH, A.ZUCCONI, B.FAZI, D.G.DRUBIN, G.CESARENI, K.SCHIRWITZ, L.CASTAGNOLI, M.J.COPE, M.WILMANNS, S.FERRACUTI
Method X-RAY DIFFRACTION (resolution: 1.30Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
PWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ACTIN BINDING PROTEIN
member of: CATH:search2.30.30.40GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10829/searchPTHR10829_SF8PFAM:searchPF00018PRINTS:searchP67PHOX/searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchP15891
JMol viewer RasMol script viewer  SO4 401A  ..                                                      *   
JMol viewer RasMol script viewer  SO4 400A  ..                                                      |   
sec str:  ....eee..................eeeeee.....eeeeee.....eeeee...eee..
sequence :  ..PWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN
seq num:  ..1         11        21        31        41        51      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            |  | ^*** |        | ||           |   || |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            |  |   |  |        | ||           ^***** |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..            |  |   |  |        ***|               |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |  |   ****        |  |               |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..            ****   ****        ****               ****    

   New search    1jo8:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors