triangle PDBeMotif: 1jdw  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.1.4.1
Classification transferase    | release date: Wed, Jan 22, 1997
Title crystal structure and mechanism of l-arginine: glycine amidinotransferase: a mitochondrial enzyme involved in creatine biosynthesis
Authors A.HUMM, E.FRITSCHE, R.HUBER, S.STEINBACHER
Method X-RAY DIFFRACTION (resolution: 1.90Å)
PDBe Citation   
Small molecules:    search BME BME binding statistics BME
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MLRVRCLRGGSRGAEAVHYIGSRLGRTLTGWVQRTFQSTQAATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIV
GRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFES
TGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAA
QGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPNPMHIDATFNIIGPGIVLSNP
DRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGITTIKVNIRNANS
LGGGFHCWTCDVRRRGTLQSYLD
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : L-ARGININE\:GLYCINE AMIDINOTRANSFERASE
member of: CATH:search3.75.10.10GENE3D:searchG3DSA_3.75.10.10PANTHER:searchPTHR10488PFAM:searchPF02274SUPERFAMILY:searchSSF55909UniProt:searchP50440
JMol viewer RasMol script viewer  BME 500A  ..                                                                                                          *                                                                                     *                                              * *                                                                                                *    *                
sec str:  ............eeeeeee............hhhhhh..hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhh...eeee........eee....eee......hhhheeee..eeee.....hhh..hhhh.hhhhhhhhh...eeee.......hhh.........hhhhhhhhhh.............hhheeee..eeee.......hhhhhhhhhhh....eeee..............eeeee..eeee........hhhhhh...eee.................hhhhh..eeee..eeeee...hhhhhhhhh...eeeee..hhhhhh.......eee.eee........
sequence :  ..CPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGITTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYLD
seq num:  ..64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    | ||||  ||    ||| |   | |  || || |  ||| |||| |   || ||| ||  || || || |||| |     | |||         |    | || |                |      |    ||||||||   |    | ||  ||  | | | || |||| |||| || ||   ||  |           | ||| |||||||||||  |     | ||    |        | ||  || |         | |||       | ||  |    ||| |  |    | ||        |  || ||||| | |  |  || |||  ||||  ||**^*  || |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | ||||  ||    ||| |   | |  || || |  ||| |||| |   || ||| ||  || || || |||^**     | ^**         |    | || |                |      |    ||||||||   |    | ||  ||  | | | || |||| |||| || ||   ||  |           | ||| |||||||||||  |     ^**|    |        | ||  || |         | |||       | ||  |    ^** |  |    | ||        |  || ||||| ^**  |  || |||  ||||  ||  |   || |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^***||  ||    ||| |   | |  || || |  ||| |||| |   || ||| ||  || || || |||        |  |          |    | || |                |      |    ||||||||   |    ^***  ||  | | ^*** |||| |||| |^***   ||  |           | ||| |||||||||||  |     ^***    |        | ||  ^***         | |||       | ||  |     |  |  |    | ||        |  || |||||      |  || |||  ||||  ||  |   ^***
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      | ||  ||    ||| |   | |  || || |  ||| |||| |   || ||| ||  || || || |||        |  |          |    | || |                *******^    ||||||||   |    | ||  ||  | |   |  |||| |||| || ||   ||  |           | ||| |||||||||||  |             |        | ||   |           | |||       | ||  |     |  |  |    | ||        |  || |||||      |  || |||  ||||  ||  |    |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      | ||  ||    ||| |   | |  || || |  ||| |||| |   || ||| ||  || || || |||        |  |          ^***** || |                            ||||||^*****    | ||  ||  | |   |  |||| |||| || ||   ||  |           | ||| |||||||||||  |             |        | ^*****           | |||       | ||  |     |  |  |    | ||        |  || |||||      |  || ||^*****|  ||  ^*****  
search RasMol script viewer Motif-ligand binding stats  TONB_DEPENDENT_REC_1 ..***********************************| |  ||| |||| |   || ||| ||  || || || |||        |  |               | || |                            ||||||||        | ||  ||  | |   |  |||| |||| || ||   ||  |           | ||| |||||||||||  |             |        |  |               | |||       | ||  |     |  |  |    | ||        |  || |||||      |  || |||  || |  ||          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | ||  ||    ||| |   | |  || || |  ||*****| |   |*************** || |||        |  |               | || |                            |*****||        | ||  ||  | |   *****|| |||| || ||   ||  |           | ||********|||*****             |        |  |               | |||       | ||  |     |  |  |    | ||        *********||      ***** |||  || |  ||          
search RasMol script viewer Motif-ligand binding stats  asxturn ..      ***|  ||    ||| |   | |  || || |  ||| |||| |   || ||  ||  |  |  || |||        |  |               | || |                            ||||||||        | ||  ||  | |   |  | || |||| || ||   ||  |           | ||| || ||||||||  |             |        |  |               | |||       | ||  |     |  |  |    ***|        |  || |||||      |  || |||  || |  ||          
search RasMol script viewer Motif-ligand binding stats  betabulge ..      |  |  **    ||| |   | |  || || |  ||| |||| |   || ||  ||  |  |  || |||        |  |               | || |                            ||||||||        | ||  ||  | |   |  | || |||| || ||   ||  |           | ||| || ||||||||  |             |        |  |               | |||       | ||  |     |  |  |    |  |        |  || |||||      |  || |||  || |  **          
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  |        ||| |   | |  ****| *************   ***************  *****|        |  |               **** |                            *******|        | ||  ||  | |   **** *****|| || ||   |****           | ||************|  |             |        ****               ****|       | ||  |     *******    |  |        **********|      ********|  || |              
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      |  |        ||| |   ***   |  |        | || |                    |  | |        |  |                 |  |                              |  | |        | ||  ||  ***        |  | || || ||   ||  |           | ||         |  |  |             |        |  |                 | |       | ||  |                |  |                | |            | |  || |              
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |        ||| |         |  |        | || |                    |  ***        |  |                 |  |                              |  ***        ***|  ||  |          |  ***| || ||   ||  |           | ||         |  |  |             |        |  |                 ***       | ||  |                |  |                ***            ***  || |              
search RasMol script viewer Motif-ligand binding stats  niche ..      ****        *****         ****        ******                    |    |        ****                 ****                              |    |           ********          |    |*******   |****           ****         *******             |        ****                           *******                ****                                    ****              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                      ******                                                               ******                             ******   | |    |               | |                              |                                                                                                       |                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                       ***    |               ***                              |                                                                                                       |                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                              *                                                *                                                                                                       *                

   New search    1jdw:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML