triangle PDBeMotif: 1i07  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification hormone/growth factor    | release date: Mon, Jan 29, 2001
Title eps8 sh3 domain intertwined dimer
Authors K.V.R.KISHAN, M.E.NEWCOMER
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : EPIDERMAL GROWTH FACTOR RECEPTOR KINASESUBSTRATE EPS8;
member of: CATH:search2.30.30.40GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR12287/searchPTHR12287_SF5PFAM:searchPF00018PFAMB:searchPB006028PROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchQ08509
sec str:  ....eeee..................eeee.hhhh.eeeee.....eeeee...eeee...
sequence :  ..KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTP
seq num:  ..6         16        26        36        46        56       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     |  |    ^***   |  |     |  |      ^***|     |  |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     ^***    |  |   |  |     |  |      | |||     |  |      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..             |  |   |  |     |  |      *****     |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..             |  |   ****     ****      ****|     |  |      
search RasMol script viewer Motif-ligand binding stats  nest ..             |  |   |  |                 ***     |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..             ****   ****                         ****      

chain B : EPIDERMAL GROWTH FACTOR RECEPTOR KINASESUBSTRATE EPS8;
member of: CATH:search2.30.30.40GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR12287/searchPTHR12287_SF5PFAM:searchPF00018PFAMB:searchPB006028PROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchQ08509
sec str:  ...eeeee..................eeee.hhhh.eeeee.....eeeee...eee....
sequence :  ..KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTP
seq num:  ..6         16        26        36        46        56       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     |  |    ^***   |  |               ^***|     |  |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     ^***    | ||   |  |                 | |     |  |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..             ***|   |  |                 | |     |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..             |  |   ****                 | |     |  |      
search RasMol script viewer Motif-ligand binding stats  nest ..             |  |   |  |                 ***     |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..             ****   ****                         ****      

   New search    1i07:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors