triangle PDBeMotif: 1hsq  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.1.4.11
Classification phosphoric diester hydrolase    | release date: Mon, Jun 13, 1994
Title solution structure of the sh3 domain of phospholipase cgamma
Authors D.KOHDA, F.INAGAKI, H.HATANAKA, M.ODAKA
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSPTFKCAVKALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVNPEGIHRD
Residue colours:  hydrophilic   hydrophobic   intermediate 
    View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PHOSPHOLIPASE C-GAMMA (SH3 DOMAIN)
member of: CATH:search2.30.30.40GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10336/searchPTHR10336_SF52PFAM:searchPF00018PIRSF:searchPIRSF000952PROSITE PROFILES:searchPS50002, SMART:searchSM00233/searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchP19174
sec str:  ........eeeee.eeee.......eee..eeee.eee....eeeeee..ee.eeeehhheeee.........
sequence :  ..GSPTFKCAVKALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVNPEGIHRD
seq num:  ..1         11        21        31        41        51        61         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ^**          | |   | ||  |             | | |  |     |  |            
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                | |   | ||  |             | | ^***     |  |            
search RasMol script viewer Motif-ligand binding stats  RGD ..                | |   | ||  |             ***          |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                | |   | |****                          |  |            
search RasMol script viewer Motif-ligand binding stats  nest ..                ***   | ||  |                          |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..                      *******                          ****            

   New search    1hsq:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML