triangle PDBeMotif: 1hcs  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification complex (signal transduction/peptide)    | release date: Fri, Sep 2, 1994
Title nmr structure of the human src sh2 domain complex
Authors R.T.GAMPE JUNIOR, R.X.XU
Method SOLUTION NMR
PDBe Citation   
Small molecules:    search ACE ACE binding statistics ACE
Modified residues:  search PTR PTR binding statistics PTR
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
YEEIE
Chain B sequence:
MDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQ
FNSLQQLVAYYSKHADGLCHRLTTVCP
Residue colours:  hydrophilic   hydrophobic   intermediate 
    View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ACETYL-PYEEIE-OH
JMol viewer RasMol script viewer  ACE 100A  ..**   
sec str:  .......
sequence :  ..YEEIE
seq num:  ..101  

chain B : HUMAN SRC
member of: CATH:search3.30.505.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF53PFAM:searchPF00017PRINTS:searchSH2DOMAIN/searchSH3DOMAINPROSITE PROFILES:searchPS50001/searchPS50002, SMART:searchSM00252/searchSM00326SUPERFAMILY:searchSSF50044/searchSSF55550UniProt:searchP12931
JMol viewer RasMol script viewer  ACE 100A  ..                                                                                                           
sec str:  .....hhh.........hhhhhhhh.........eeeee.......eeeeeeee.....eeeeeeeeeee...eee.........hhhhhhhh................
sequence :  ..MDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCP
seq num:  ..140       150       160       170       180       190       200       210       220       230       240    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..      |  |    |**^* ||| |  ||  |       | |     |  |                  | |   | |       |  | ||||| |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      |  |    ^**|^**|| |  ||  |       ^**     |  |                  | |   ^**       |  | ||||| |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      |  |    ^***|  || |  ||  |               ^***                  | |             |  | ||||| |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      |  |        ***** |  ||  |                                     | |             |  *****|| |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  |        ****  ********                                     | |             ******* || |          
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |              |  ||  |                                     ***                  |  |***          
search RasMol script viewer Motif-ligand binding stats  niche ..      ****              ********                                                          ****             

   New search    1hcs:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML